NP_001155193.2 has 247 amino acids
Query: DUF640 [M=126] Accession: PF04852.12 Description: Protein of unknown function (DUF640) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-70 220.0 0.2 7.9e-70 219.1 0.2 1.4 1 NP_001155193.2 Domain annotation for each sequence (and alignments): >> NP_001155193.2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 219.1 0.2 7.9e-70 7.9e-70 2 126 .] 41 165 .. 40 165 .. 0.98 Alignments for each domain: == domain 1 score: 219.1 bits; conditional E-value: 7.9e-70 DUF640 2 sssaskPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrl 96 ++++ +P++lsryesqkrrdwntf++yl+++rPPl+larcsgahv+efl+yldqfGktkvha+ c+++Gq++++apc cPl+qawGsldaliGrl NP_001155193.2 41 AQAQPQPHQLSRYESQKRRDWNTFLQYLQNHRPPLTLARCSGAHVIEFLKYLDQFGKTKVHAAGCAHFGQPSPPAPCPCPLHQAWGSLDALIGRL 135 5678899**************************************************************************************** PP DUF640 97 raafeeeggkaeanPfaaravrlylrevrd 126 raa+ee+g+ +e+nPfaaravr+ylr+vrd NP_001155193.2 136 RAAYEESGHAPESNPFAARAVRIYLRDVRD 165 *****************************8 PP
Or compare NP_001155193.2 to CDD or PaperBLAST