PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001306073.1 to PF04852 (DUF640)

NP_001306073.1 has 208 amino acids

Query:       DUF640  [M=126]
Accession:   PF04852.12
Description: Protein of unknown function (DUF640)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    7.3e-72  225.7   0.1    1.2e-71  225.0   0.1    1.3  1  NP_001306073.1  


Domain annotation for each sequence (and alignments):
>> NP_001306073.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  225.0   0.1   1.2e-71   1.2e-71       2     126 .]      48     172 ..      47     172 .. 0.98

  Alignments for each domain:
  == domain 1  score: 225.0 bits;  conditional E-value: 1.2e-71
          DUF640   2 sssaskPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrl 96 
                     sss+++P++lsrye+qkrrdwntf +yl+++rPPl+l+rcsgahvleflryldqfGktkvh++ c+f+G+++++apc cPlrqawGsldaliGrl
  NP_001306073.1  48 SSSSNSPTTLSRYENQKRRDWNTFGQYLRNHRPPLSLTRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFGHPNPPAPCPCPLRQAWGSLDALIGRL 142
                     678899***************************************************************************************** PP

          DUF640  97 raafeeeggkaeanPfaaravrlylrevrd 126
                     raa+ee+ggk+e+nPf+aravrlylrevrd
  NP_001306073.1 143 RAAYEENGGKPETNPFGARAVRLYLREVRD 172
                     *****************************8 PP



Or compare NP_001306073.1 to CDD or PaperBLAST