NP_001306073.1 has 208 amino acids
Query: ALOG_dom [M=126] Accession: PF04852.16 Description: ALOG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.7e-73 228.7 0.1 1.4e-72 228.0 0.1 1.3 1 NP_001306073.1 Domain annotation for each sequence (and alignments): >> NP_001306073.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 228.0 0.1 1.4e-72 1.4e-72 2 126 .] 48 172 .. 47 172 .. 0.99 Alignments for each domain: == domain 1 score: 228.0 bits; conditional E-value: 1.4e-72 ALOG_dom 2 ssseskPkalsryesqkrrdwntfvqylknkrPPlelarcsgahvleflryldqfGktkvhaeacvffGqaepaapckcPlrqawGsldaliGrl 96 sss+++P++lsrye+qkrrdwntf qyl+n+rPPl+l+rcsgahvleflryldqfGktkvh++ c+ffG+++p+apc cPlrqawGsldaliGrl NP_001306073.1 48 SSSSNSPTTLSRYENQKRRDWNTFGQYLRNHRPPLSLTRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFGHPNPPAPCPCPLRQAWGSLDALIGRL 142 678999***************************************************************************************** PP ALOG_dom 97 raafeenggkaesnPfaaravrvylrevre 126 raa+eenggk+e+nPf+aravr+ylrevr+ NP_001306073.1 143 RAAYEENGGKPETNPFGARAVRLYLREVRD 172 *****************************8 PP
Or compare NP_001306073.1 to CDD or PaperBLAST