NP_001306073.1 has 208 amino acids
Query: DUF640 [M=126] Accession: PF04852.12 Description: Protein of unknown function (DUF640) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.3e-72 225.7 0.1 1.2e-71 225.0 0.1 1.3 1 NP_001306073.1 Domain annotation for each sequence (and alignments): >> NP_001306073.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 225.0 0.1 1.2e-71 1.2e-71 2 126 .] 48 172 .. 47 172 .. 0.98 Alignments for each domain: == domain 1 score: 225.0 bits; conditional E-value: 1.2e-71 DUF640 2 sssaskPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrl 96 sss+++P++lsrye+qkrrdwntf +yl+++rPPl+l+rcsgahvleflryldqfGktkvh++ c+f+G+++++apc cPlrqawGsldaliGrl NP_001306073.1 48 SSSSNSPTTLSRYENQKRRDWNTFGQYLRNHRPPLSLTRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFGHPNPPAPCPCPLRQAWGSLDALIGRL 142 678899***************************************************************************************** PP DUF640 97 raafeeeggkaeanPfaaravrlylrevrd 126 raa+ee+ggk+e+nPf+aravrlylrevrd NP_001306073.1 143 RAAYEENGGKPETNPFGARAVRLYLREVRD 172 *****************************8 PP
Or compare NP_001306073.1 to CDD or PaperBLAST