NP_193685.6 has 1309 amino acids
Query: ALOG_dom [M=126] Accession: PF04852.16 Description: ALOG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-15 43.5 0.1 2.2e-10 27.0 0.0 3.2 3 NP_193685.6 Domain annotation for each sequence (and alignments): >> NP_193685.6 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 27.0 0.0 2.2e-10 2.2e-10 18 59 .. 493 534 .. 482 535 .. 0.90 2 ! 15.8 0.0 6.7e-07 6.7e-07 83 126 .] 528 571 .. 526 571 .. 0.95 3 ? -0.0 0.0 0.051 0.051 12 43 .. 889 924 .. 879 933 .. 0.79 Alignments for each domain: == domain 1 score: 27.0 bits; conditional E-value: 2.2e-10 ALOG_dom 18 krrdwntfvqylknkrPPlelarcsgahvleflryldqfGkt 59 + dw +f+++l+n+ PPl+ +cs+++v++flr + G t NP_193685.6 493 SNDDWCSFCEFLRNRIPPLNPFKCSANDVIDFLRTRQVLGST 534 4679******************************99988877 PP == domain 2 score: 15.8 bits; conditional E-value: 6.7e-07 ALOG_dom 83 rqawGsldaliGrlraafeenggkaesnPfaaravrvylrevre 126 rq Gs +al+ rl e g k+e+nPf ++av yl+ r+ NP_193685.6 528 RQVLGSTEALVDRLIFSSEAFGIKPEENPFRSQAVTSYLKAARD 571 899***********999999********************9886 PP == domain 3 score: -0.0 bits; conditional E-value: 0.051 ALOG_dom 12 sryesqkrrdwntf...vqylknkrPPl.elarcsg 43 ye qk d+++f qyl+ ++P + el++cs+ NP_193685.6 889 KPYEIQKLSDFESFrlcKQYLDGENPVIsELISCSS 924 56999*******9955459******98734777775 PP
Or compare NP_193685.6 to CDD or PaperBLAST