PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10078877 to PF04852 (DUF640)

VIMSS10078877 has 196 amino acids

Query:       DUF640  [M=126]
Accession:   PF04852.12
Description: Protein of unknown function (DUF640)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    2.1e-70  221.0   0.1    3.2e-70  220.4   0.1    1.2  1  VIMSS10078877  


Domain annotation for each sequence (and alignments):
>> VIMSS10078877  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  220.4   0.1   3.2e-70   3.2e-70       6     126 .]      24     144 ..      20     144 .. 0.98

  Alignments for each domain:
  == domain 1  score: 220.4 bits;  conditional E-value: 3.2e-70
         DUF640   6 skPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlraafe 101
                    s P++ sryesqkrrdwntf++ylk+++PPl l+rcsgahv+efl+yldqfGktkvh++ac+++G++++++pc+cPl+qawGsldaliGrlraa+e
  VIMSS10078877  24 SPPATPSRYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGHQQPPSPCSCPLKQAWGSLDALIGRLRAAYE 119
                    568999****************************************************************************************** PP

         DUF640 102 eeggkaeanPfaaravrlylrevrd 126
                    e+gg++++nPfaaravr+ylrevr+
  VIMSS10078877 120 ENGGRPDSNPFAARAVRIYLREVRE 144
                    ***********************97 PP



Or compare VIMSS10078877 to CDD or PaperBLAST