VIMSS10078877 has 196 amino acids
Query: DUF640 [M=126] Accession: PF04852.12 Description: Protein of unknown function (DUF640) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-70 221.0 0.1 3.2e-70 220.4 0.1 1.2 1 VIMSS10078877 Domain annotation for each sequence (and alignments): >> VIMSS10078877 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 220.4 0.1 3.2e-70 3.2e-70 6 126 .] 24 144 .. 20 144 .. 0.98 Alignments for each domain: == domain 1 score: 220.4 bits; conditional E-value: 3.2e-70 DUF640 6 skPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlraafe 101 s P++ sryesqkrrdwntf++ylk+++PPl l+rcsgahv+efl+yldqfGktkvh++ac+++G++++++pc+cPl+qawGsldaliGrlraa+e VIMSS10078877 24 SPPATPSRYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGHQQPPSPCSCPLKQAWGSLDALIGRLRAAYE 119 568999****************************************************************************************** PP DUF640 102 eeggkaeanPfaaravrlylrevrd 126 e+gg++++nPfaaravr+ylrevr+ VIMSS10078877 120 ENGGRPDSNPFAARAVRIYLREVRE 144 ***********************97 PP
Or compare VIMSS10078877 to CDD or PaperBLAST