VIMSS10080010 has 164 amino acids
Query: DUF640 [M=126] Accession: PF04852.12 Description: Protein of unknown function (DUF640) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-65 203.5 0.0 6.4e-65 203.3 0.0 1.1 1 VIMSS10080010 Domain annotation for each sequence (and alignments): >> VIMSS10080010 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 203.3 0.0 6.4e-65 6.4e-65 6 125 .. 16 135 .. 11 136 .. 0.97 Alignments for each domain: == domain 1 score: 203.3 bits; conditional E-value: 6.4e-65 DUF640 6 skPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlraafe 101 P++lsryesqk rdwntf++yl++k+PP+++++c+++h+l+fl+ +dqfGktkvh++ cvf+Gq+e++++c+cPl+qawGsldaliGrlraa+e VIMSS10080010 16 GPPPTLSRYESQKSRDWNTFCQYLMTKMPPVHVWECESNHILDFLQSRDQFGKTKVHIQGCVFFGQKEPPGECNCPLKQAWGSLDALIGRLRAAYE 111 5688******************************************************************************************** PP DUF640 102 eeggkaeanPfaaravrlylrevr 125 e+gg +e+nPfa+ ++r++lrevr VIMSS10080010 112 ENGGLTEKNPFARGGIRIFLREVR 135 ***********************9 PP
Or compare VIMSS10080010 to CDD or PaperBLAST