VIMSS10080010 has 164 amino acids
Query: ALOG_dom [M=126] Accession: PF04852.16 Description: ALOG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-67 209.3 0.0 1e-66 209.1 0.0 1.1 1 VIMSS10080010 Domain annotation for each sequence (and alignments): >> VIMSS10080010 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 209.1 0.0 1e-66 1e-66 5 125 .. 15 135 .. 11 136 .. 0.97 Alignments for each domain: == domain 1 score: 209.1 bits; conditional E-value: 1e-66 ALOG_dom 5 eskPkalsryesqkrrdwntfvqylknkrPPlelarcsgahvleflryldqfGktkvhaeacvffGqaepaapckcPlrqawGsldaliGrlraaf 100 e +P++lsryesqk+rdwntf+qyl++k+PP+++++c+++h+l+fl+ +dqfGktkvh++ cvffGq+ep+++c+cPl+qawGsldaliGrlraa+ VIMSS10080010 15 EGPPPTLSRYESQKSRDWNTFCQYLMTKMPPVHVWECESNHILDFLQSRDQFGKTKVHIQGCVFFGQKEPPGECNCPLKQAWGSLDALIGRLRAAY 110 55789******************************************************************************************* PP ALOG_dom 101 eenggkaesnPfaaravrvylrevr 125 eengg +e+nPfa+ ++r++lrevr VIMSS10080010 111 EENGGLTEKNPFARGGIRIFLREVR 135 ************************9 PP
Or compare VIMSS10080010 to CDD or PaperBLAST