PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10080010 to PF04852 (DUF640)

VIMSS10080010 has 164 amino acids

Query:       DUF640  [M=126]
Accession:   PF04852.12
Description: Protein of unknown function (DUF640)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    5.4e-65  203.5   0.0    6.4e-65  203.3   0.0    1.1  1  VIMSS10080010  


Domain annotation for each sequence (and alignments):
>> VIMSS10080010  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  203.3   0.0   6.4e-65   6.4e-65       6     125 ..      16     135 ..      11     136 .. 0.97

  Alignments for each domain:
  == domain 1  score: 203.3 bits;  conditional E-value: 6.4e-65
         DUF640   6 skPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlraafe 101
                      P++lsryesqk rdwntf++yl++k+PP+++++c+++h+l+fl+ +dqfGktkvh++ cvf+Gq+e++++c+cPl+qawGsldaliGrlraa+e
  VIMSS10080010  16 GPPPTLSRYESQKSRDWNTFCQYLMTKMPPVHVWECESNHILDFLQSRDQFGKTKVHIQGCVFFGQKEPPGECNCPLKQAWGSLDALIGRLRAAYE 111
                    5688******************************************************************************************** PP

         DUF640 102 eeggkaeanPfaaravrlylrevr 125
                    e+gg +e+nPfa+ ++r++lrevr
  VIMSS10080010 112 ENGGLTEKNPFARGGIRIFLREVR 135
                    ***********************9 PP



Or compare VIMSS10080010 to CDD or PaperBLAST