PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10086364 to PF04852 (DUF640)

VIMSS10086364 has 195 amino acids

Query:       DUF640  [M=126]
Accession:   PF04852.12
Description: Protein of unknown function (DUF640)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
      1e-67  212.3   0.0    1.5e-67  211.7   0.0    1.2  1  VIMSS10086364  


Domain annotation for each sequence (and alignments):
>> VIMSS10086364  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  211.7   0.0   1.5e-67   1.5e-67       3     126 .]      30     153 ..      27     153 .. 0.97

  Alignments for each domain:
  == domain 1  score: 211.7 bits;  conditional E-value: 1.5e-67
         DUF640   3 ssaskPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlra 98 
                    +s  +P++lsryesqkrrdwntf++yl++++PP+++++c ++h+l+fl+yldqfGktkvh++ cvf+Gq e+a++c+cPl+qawGsldaliGrlra
  VIMSS10086364  30 QSPPNPPALSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFGQVEPAGQCNCPLKQAWGSLDALIGRLRA 125
                    5667789***************************************************************************************** PP

         DUF640  99 afeeeggkaeanPfaaravrlylrevrd 126
                    afee+gg +e nPfa  ++r++lrevrd
  VIMSS10086364 126 AFEENGGLPERNPFAGGGIRVFLREVRD 153
                    ***************************8 PP



Or compare VIMSS10086364 to CDD or PaperBLAST