VIMSS10086364 has 195 amino acids
Query: ALOG_dom [M=126] Accession: PF04852.16 Description: ALOG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-69 217.3 0.0 4.4e-69 216.7 0.0 1.2 1 VIMSS10086364 Domain annotation for each sequence (and alignments): >> VIMSS10086364 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 216.7 0.0 4.4e-69 4.4e-69 2 126 .] 29 153 .. 28 153 .. 0.98 Alignments for each domain: == domain 1 score: 216.7 bits; conditional E-value: 4.4e-69 ALOG_dom 2 ssseskPkalsryesqkrrdwntfvqylknkrPPlelarcsgahvleflryldqfGktkvhaeacvffGqaepaapckcPlrqawGsldaliGrlr 97 ++s +P+alsryesqkrrdwntf+qyl+n++PP+++++c ++h+l+fl+yldqfGktkvh++ cvffGq epa++c+cPl+qawGsldaliGrlr VIMSS10086364 29 PQSPPNPPALSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFGQVEPAGQCNCPLKQAWGSLDALIGRLR 124 56778899**************************************************************************************** PP ALOG_dom 98 aafeenggkaesnPfaaravrvylrevre 126 aafeengg +e+nPfa ++rv+lrevr+ VIMSS10086364 125 AAFEENGGLPERNPFAGGGIRVFLREVRD 153 ****************************8 PP
Or compare VIMSS10086364 to CDD or PaperBLAST