VIMSS10091480 has 177 amino acids
Query: DUF640 [M=126] Accession: PF04852.12 Description: Protein of unknown function (DUF640) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-69 218.2 0.0 1.9e-69 217.9 0.0 1.1 1 VIMSS10091480 Domain annotation for each sequence (and alignments): >> VIMSS10091480 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 217.9 0.0 1.9e-69 1.9e-69 3 126 .] 15 138 .. 13 138 .. 0.97 Alignments for each domain: == domain 1 score: 217.9 bits; conditional E-value: 1.9e-69 DUF640 3 ssaskPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlra 98 s ++ P + sryesqkrrdwntf +ylk++rPP+ +++cs++hvl+flryldqfGktkvh++ c+fyGq+e++apc+cPlrqawGsldaliGrlra VIMSS10091480 15 SGSEPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRA 110 556778999*************************************************************************************** PP DUF640 99 afeeeggkaeanPfaaravrlylrevrd 126 a+ee+gg +e+nPfa+ a+r+ylrevr+ VIMSS10091480 111 AYEENGGPPETNPFASGAIRVYLREVRE 138 **************************97 PP
Or compare VIMSS10091480 to CDD or PaperBLAST