PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10091480 to PF04852 (DUF640)

VIMSS10091480 has 177 amino acids

Query:       DUF640  [M=126]
Accession:   PF04852.12
Description: Protein of unknown function (DUF640)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    1.5e-69  218.2   0.0    1.9e-69  217.9   0.0    1.1  1  VIMSS10091480  


Domain annotation for each sequence (and alignments):
>> VIMSS10091480  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  217.9   0.0   1.9e-69   1.9e-69       3     126 .]      15     138 ..      13     138 .. 0.97

  Alignments for each domain:
  == domain 1  score: 217.9 bits;  conditional E-value: 1.9e-69
         DUF640   3 ssaskPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlra 98 
                    s ++ P + sryesqkrrdwntf +ylk++rPP+ +++cs++hvl+flryldqfGktkvh++ c+fyGq+e++apc+cPlrqawGsldaliGrlra
  VIMSS10091480  15 SGSEPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRA 110
                    556778999*************************************************************************************** PP

         DUF640  99 afeeeggkaeanPfaaravrlylrevrd 126
                    a+ee+gg +e+nPfa+ a+r+ylrevr+
  VIMSS10091480 111 AYEENGGPPETNPFASGAIRVYLREVRE 138
                    **************************97 PP



Or compare VIMSS10091480 to CDD or PaperBLAST