PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10092510 to PF04852 (DUF640)

VIMSS10092510 has 201 amino acids

Query:       DUF640  [M=126]
Accession:   PF04852.12
Description: Protein of unknown function (DUF640)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    4.2e-69  216.8   1.6    4.4e-69  216.7   0.1    1.7  2  VIMSS10092510  


Domain annotation for each sequence (and alignments):
>> VIMSS10092510  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  216.7   0.1   4.4e-69   4.4e-69       3     126 .]      23     146 ..      21     146 .. 0.98
   2 ?   -1.4   0.2      0.14      0.14      13      37 ..     155     180 ..     148     191 .. 0.65

  Alignments for each domain:
  == domain 1  score: 216.7 bits;  conditional E-value: 4.4e-69
         DUF640   3 ssaskPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlra 98 
                    ss s+P+++srye+qkrrdwntf++yl++++PPl+la+csgahvl+flryldqfGktkvh+++c+f+G ++++apc cPlrqawGsldaliGrlra
  VIMSS10092510  23 SSFSSPPSSSRYENQKRRDWNTFCQYLRNHHPPLSLASCSGAHVLDFLRYLDQFGKTKVHHQNCAFFGLPNPPAPCPCPLRQAWGSLDALIGRLRA 118
                    5678899***************************************************************************************** PP

         DUF640  99 afeeeggkaeanPfaaravrlylrevrd 126
                    a+ee+gg +e++Pf++r+vr++lrevrd
  VIMSS10092510 119 AYEENGGAPETSPFGSRSVRIFLREVRD 146
                    ***************************8 PP

  == domain 2  score: -1.4 bits;  conditional E-value: 0.14
         DUF640  13 ryesqkrr.dwntfvrylkakrPPle 37 
                    +ye++++r + + +++   + +PPl 
  VIMSS10092510 155 SYEKKRKRvNNKQITQSQPQSQPPLP 180
                    67777666134456677777778775 PP



Or compare VIMSS10092510 to CDD or PaperBLAST