VIMSS10092510 has 201 amino acids
Query: ALOG_dom [M=126] Accession: PF04852.16 Description: ALOG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-70 221.5 1.6 1.5e-70 221.4 0.1 1.7 2 VIMSS10092510 Domain annotation for each sequence (and alignments): >> VIMSS10092510 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 221.4 0.1 1.5e-70 1.5e-70 3 126 .] 23 146 .. 21 146 .. 0.98 2 ? -1.4 0.2 0.14 0.14 12 37 .. 154 180 .. 148 191 .. 0.65 Alignments for each domain: == domain 1 score: 221.4 bits; conditional E-value: 1.5e-70 ALOG_dom 3 sseskPkalsryesqkrrdwntfvqylknkrPPlelarcsgahvleflryldqfGktkvhaeacvffGqaepaapckcPlrqawGsldaliGrlra 98 ss s+P+++srye+qkrrdwntf+qyl+n++PPl+la+csgahvl+flryldqfGktkvh+++c+ffG ++p+apc cPlrqawGsldaliGrlra VIMSS10092510 23 SSFSSPPSSSRYENQKRRDWNTFCQYLRNHHPPLSLASCSGAHVLDFLRYLDQFGKTKVHHQNCAFFGLPNPPAPCPCPLRQAWGSLDALIGRLRA 118 6778899***************************************************************************************** PP ALOG_dom 99 afeenggkaesnPfaaravrvylrevre 126 a+eengg +e++Pf++r+vr++lrevr+ VIMSS10092510 119 AYEENGGAPETSPFGSRSVRIFLREVRD 146 ***************************8 PP == domain 2 score: -1.4 bits; conditional E-value: 0.14 ALOG_dom 12 sryesqkrrdwn.tfvqylknkrPPle 37 +ye++++r n ++q + +PPl VIMSS10092510 154 VSYEKKRKRVNNkQITQSQPQSQPPLP 180 467777776444155666667777775 PP
Or compare VIMSS10092510 to CDD or PaperBLAST