PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10101478 to PF04852 (DUF640)

VIMSS10101478 has 191 amino acids

Query:       DUF640  [M=126]
Accession:   PF04852.12
Description: Protein of unknown function (DUF640)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    1.2e-65  205.7   0.1    1.7e-65  205.1   0.1    1.2  1  VIMSS10101478  


Domain annotation for each sequence (and alignments):
>> VIMSS10101478  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  205.1   0.1   1.7e-65   1.7e-65       5     126 .]      31     151 ..      21     151 .. 0.95

  Alignments for each domain:
  == domain 1  score: 205.1 bits;  conditional E-value: 1.7e-65
         DUF640   5 askPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlraaf 100
                     ++P  lsryesqkrrdwntfv+ylk+++PPl++++ +++hvl+flryldqfGktkvh++acvf+Gq+++++pc+cPl+qawGsldaliGrlraa+
  VIMSS10101478  31 PQQP--LSRYESQKRRDWNTFVQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQPDPPGPCTCPLKQAWGSLDALIGRLRAAY 124
                    3444..9***************************************************************************************** PP

         DUF640 101 ee.eggkaeanPfaaravrlylrevrd 126
                    ee  gg++++nPfa+ ++r++lrevr+
  VIMSS10101478 125 EEhGGGSPDTNPFANGSIRVHLREVRE 151
                    **667899*****************97 PP



Or compare VIMSS10101478 to CDD or PaperBLAST