VIMSS10101478 has 191 amino acids
Query: DUF640 [M=126] Accession: PF04852.12 Description: Protein of unknown function (DUF640) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-65 205.7 0.1 1.7e-65 205.1 0.1 1.2 1 VIMSS10101478 Domain annotation for each sequence (and alignments): >> VIMSS10101478 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 205.1 0.1 1.7e-65 1.7e-65 5 126 .] 31 151 .. 21 151 .. 0.95 Alignments for each domain: == domain 1 score: 205.1 bits; conditional E-value: 1.7e-65 DUF640 5 askPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlraaf 100 ++P lsryesqkrrdwntfv+ylk+++PPl++++ +++hvl+flryldqfGktkvh++acvf+Gq+++++pc+cPl+qawGsldaliGrlraa+ VIMSS10101478 31 PQQP--LSRYESQKRRDWNTFVQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQPDPPGPCTCPLKQAWGSLDALIGRLRAAY 124 3444..9***************************************************************************************** PP DUF640 101 ee.eggkaeanPfaaravrlylrevrd 126 ee gg++++nPfa+ ++r++lrevr+ VIMSS10101478 125 EEhGGGSPDTNPFANGSIRVHLREVRE 151 **667899*****************97 PP
Or compare VIMSS10101478 to CDD or PaperBLAST