PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10106928 to PF04852 (DUF640)

VIMSS10106928 has 190 amino acids

Query:       DUF640  [M=126]
Accession:   PF04852.12
Description: Protein of unknown function (DUF640)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    1.8e-69  218.0   0.1    1.8e-69  218.0   0.1    1.8  2  VIMSS10106928  


Domain annotation for each sequence (and alignments):
>> VIMSS10106928  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  218.0   0.1   1.8e-69   1.8e-69       3     126 .]      15     138 ..      13     138 .. 0.97
   2 ?   -0.9   0.7     0.097     0.097      13      42 ..     147     172 ..     140     177 .. 0.71

  Alignments for each domain:
  == domain 1  score: 218.0 bits;  conditional E-value: 1.8e-69
         DUF640   3 ssaskPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlra 98 
                    s++ +P+++srye+qkrrdwntf++yl+++rPPl+l +csgahvleflryldqfGktkvh+++c+f+G ++++apc cPlrqawGsldaliGrlra
  VIMSS10106928  15 STQLTPPSSSRYENQKRRDWNTFCQYLRNHRPPLSLPSCSGAHVLEFLRYLDQFGKTKVHHQNCAFFGLPNPPAPCPCPLRQAWGSLDALIGRLRA 110
                    5677889***************************************************************************************** PP

         DUF640  99 afeeeggkaeanPfaaravrlylrevrd 126
                    a+ee+gg +eanPf++ravrl+lrevrd
  VIMSS10106928 111 AYEENGGPPEANPFGSRAVRLFLREVRD 138
                    ***************************8 PP

  == domain 2  score: -0.9 bits;  conditional E-value: 0.097
         DUF640  13 ryesqkrrdwntfvrylkakrPPlelarcs 42 
                    +ye++++r      r   + +PPl+l++ +
  VIMSS10106928 147 SYEKKRKR----VNRQKPQTQPPLQLQQQQ 172
                    56666666....566667889999998765 PP



Or compare VIMSS10106928 to CDD or PaperBLAST