VIMSS10106928 has 190 amino acids
Query: DUF640 [M=126] Accession: PF04852.12 Description: Protein of unknown function (DUF640) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-69 218.0 0.1 1.8e-69 218.0 0.1 1.8 2 VIMSS10106928 Domain annotation for each sequence (and alignments): >> VIMSS10106928 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 218.0 0.1 1.8e-69 1.8e-69 3 126 .] 15 138 .. 13 138 .. 0.97 2 ? -0.9 0.7 0.097 0.097 13 42 .. 147 172 .. 140 177 .. 0.71 Alignments for each domain: == domain 1 score: 218.0 bits; conditional E-value: 1.8e-69 DUF640 3 ssaskPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlra 98 s++ +P+++srye+qkrrdwntf++yl+++rPPl+l +csgahvleflryldqfGktkvh+++c+f+G ++++apc cPlrqawGsldaliGrlra VIMSS10106928 15 STQLTPPSSSRYENQKRRDWNTFCQYLRNHRPPLSLPSCSGAHVLEFLRYLDQFGKTKVHHQNCAFFGLPNPPAPCPCPLRQAWGSLDALIGRLRA 110 5677889***************************************************************************************** PP DUF640 99 afeeeggkaeanPfaaravrlylrevrd 126 a+ee+gg +eanPf++ravrl+lrevrd VIMSS10106928 111 AYEENGGPPEANPFGSRAVRLFLREVRD 138 ***************************8 PP == domain 2 score: -0.9 bits; conditional E-value: 0.097 DUF640 13 ryesqkrrdwntfvrylkakrPPlelarcs 42 +ye++++r r + +PPl+l++ + VIMSS10106928 147 SYEKKRKR----VNRQKPQTQPPLQLQQQQ 172 56666666....566667889999998765 PP
Or compare VIMSS10106928 to CDD or PaperBLAST