PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10110423 to PF04852 (DUF640)

VIMSS10110423 has 182 amino acids

Query:       DUF640  [M=126]
Accession:   PF04852.12
Description: Protein of unknown function (DUF640)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    2.6e-69  217.4   0.1    3.4e-69  217.1   0.1    1.1  1  VIMSS10110423  


Domain annotation for each sequence (and alignments):
>> VIMSS10110423  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  217.1   0.1   3.4e-69   3.4e-69       4     126 .]      13     133 ..       7     133 .. 0.95

  Alignments for each domain:
  == domain 1  score: 217.1 bits;  conditional E-value: 3.4e-69
         DUF640   4 saskPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlraa 99 
                    s+s   + sryesqkrrdwntf++yl++++PPl+l+rcsgahvlefl+yldqfGktkvha+ac+f+Gq++++++c+cPl+qawGsldaliGrlraa
  VIMSS10110423  13 SSS---SPSRYESQKRRDWNTFLQYLRNHKPPLNLSRCSGAHVLEFLKYLDQFGKTKVHATACPFFGQPNPPSQCTCPLKQAWGSLDALIGRLRAA 105
                    344...45**************************************************************************************** PP

         DUF640 100 fee.eggkaeanPfaaravrlylrevrd 126
                    fee  gg +e+nPfaa+avr+yl+evr+
  VIMSS10110423 106 FEEiGGGLPESNPFAAKAVRIYLKEVRQ 133
                    ***9999*******************96 PP



Or compare VIMSS10110423 to CDD or PaperBLAST