XP_004233194.1 has 181 amino acids
Query: DUF640 [M=126] Accession: PF04852.12 Description: Protein of unknown function (DUF640) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-68 213.1 0.5 8.8e-68 212.5 0.0 1.4 2 XP_004233194.1 Domain annotation for each sequence (and alignments): >> XP_004233194.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 212.5 0.0 8.8e-68 8.8e-68 6 126 .] 31 151 .. 28 151 .. 0.98 2 ? -3.0 0.1 0.44 0.44 13 21 .. 160 168 .. 154 172 .. 0.78 Alignments for each domain: == domain 1 score: 212.5 bits; conditional E-value: 8.8e-68 DUF640 6 skPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlraaf 100 s+P+++srye qkrrdwntf +yl++++PPl larcsga++lefl+yldqfGktkvh +c+f+G ++++apc+cPl+qawGsldaliGrlraaf XP_004233194.1 31 SSPPTVSRYELQKRRDWNTFGQYLRNHKPPLILARCSGANILEFLKYLDQFGKTKVHSCNCPFFGDPHPPAPCNCPLKQAWGSLDALIGRLRAAF 125 5788******************************************************************************************* PP DUF640 101 eeeggkaeanPfaaravrlylrevrd 126 ee+gg++e+nPf+aravrlyl+evrd XP_004233194.1 126 EENGGRTETNPFGARAVRLYLKEVRD 151 *************************8 PP == domain 2 score: -3.0 bits; conditional E-value: 0.44 DUF640 13 ryesqkrrd 21 ye++krr+ XP_004233194.1 160 AYEKKKRRN 168 699999996 PP
Or compare XP_004233194.1 to CDD or PaperBLAST