PaperBLAST – Find papers about a protein or its homologs

 

Align XP_004233194.1 to PF04852 (DUF640)

XP_004233194.1 has 181 amino acids

Query:       DUF640  [M=126]
Accession:   PF04852.12
Description: Protein of unknown function (DUF640)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    5.8e-68  213.1   0.5    8.8e-68  212.5   0.0    1.4  2  XP_004233194.1  


Domain annotation for each sequence (and alignments):
>> XP_004233194.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  212.5   0.0   8.8e-68   8.8e-68       6     126 .]      31     151 ..      28     151 .. 0.98
   2 ?   -3.0   0.1      0.44      0.44      13      21 ..     160     168 ..     154     172 .. 0.78

  Alignments for each domain:
  == domain 1  score: 212.5 bits;  conditional E-value: 8.8e-68
          DUF640   6 skPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlraaf 100
                     s+P+++srye qkrrdwntf +yl++++PPl larcsga++lefl+yldqfGktkvh  +c+f+G ++++apc+cPl+qawGsldaliGrlraaf
  XP_004233194.1  31 SSPPTVSRYELQKRRDWNTFGQYLRNHKPPLILARCSGANILEFLKYLDQFGKTKVHSCNCPFFGDPHPPAPCNCPLKQAWGSLDALIGRLRAAF 125
                     5788******************************************************************************************* PP

          DUF640 101 eeeggkaeanPfaaravrlylrevrd 126
                     ee+gg++e+nPf+aravrlyl+evrd
  XP_004233194.1 126 EENGGRTETNPFGARAVRLYLKEVRD 151
                     *************************8 PP

  == domain 2  score: -3.0 bits;  conditional E-value: 0.44
          DUF640  13 ryesqkrrd 21 
                      ye++krr+
  XP_004233194.1 160 AYEKKKRRN 168
                     699999996 PP



Or compare XP_004233194.1 to CDD or PaperBLAST