PaperBLAST – Find papers about a protein or its homologs

 

Align XP_004239743.1 to PF04852 (DUF640)

XP_004239743.1 has 211 amino acids

Query:       DUF640  [M=126]
Accession:   PF04852.12
Description: Protein of unknown function (DUF640)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.2e-67  210.7   0.0      5e-67  210.1   0.0    1.3  1  XP_004239743.1  


Domain annotation for each sequence (and alignments):
>> XP_004239743.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  210.1   0.0     5e-67     5e-67       8     126 .]      37     154 ..      30     154 .. 0.97

  Alignments for each domain:
  == domain 1  score: 210.1 bits;  conditional E-value: 5e-67
          DUF640   8 PkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlraafee 102
                     P  lsrye+qkrrdwntf++y+++++PPl+l +c +ah+leflryldqfGktkvh+++c+f+G  +++apc cPlrqawGsldaliGrlraa+ee
  XP_004239743.1  37 P-PLSRYENQKRRDWNTFCQYVRNHQPPLSLPQCTSAHILEFLRYLDQFGKTKVHNQNCPFFGLLNPPAPCPCPLRQAWGSLDALIGRLRAAYEE 130
                     3.59******************************************************************************************* PP

          DUF640 103 eggkaeanPfaaravrlylrevrd 126
                     +ggk+e+nPf++r vrl+lrevrd
  XP_004239743.1 131 NGGKPEMNPFGSRNVRLFLREVRD 154
                     ***********************8 PP



Or compare XP_004239743.1 to CDD or PaperBLAST