PaperBLAST – Find papers about a protein or its homologs

 

Align XP_010098512.1 to PF04852 (DUF640)

XP_010098512.1 has 245 amino acids

Query:       DUF640  [M=126]
Accession:   PF04852.12
Description: Protein of unknown function (DUF640)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.5e-71  224.7   0.4    2.3e-71  224.1   0.1    1.5  2  XP_010098512.1  


Domain annotation for each sequence (and alignments):
>> XP_010098512.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  224.1   0.1   2.3e-71   2.3e-71       5     126 .]      43     164 ..      39     164 .. 0.98
   2 ?   -3.4   0.0      0.57      0.57      15      24 ..     175     184 ..     170     205 .. 0.56

  Alignments for each domain:
  == domain 1  score: 224.1 bits;  conditional E-value: 2.3e-71
          DUF640   5 askPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlraa 99 
                      ++P++lsryesqkrrdwntf +ylk++rPPl+l+rcsgahvleflryldqfGktkvh ++c+fyG+++++apc cPlrqawGsldaliGrlraa
  XP_010098512.1  43 PQQPPSLSRYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHSDTCPFYGKPQPPAPCPCPLRQAWGSLDALIGRLRAA 137
                     46888****************************************************************************************** PP

          DUF640 100 feeeggkaeanPfaaravrlylrevrd 126
                     fee+ggk+e+nPf+aravrlylrevrd
  XP_010098512.1 138 FEENGGKPETNPFGARAVRLYLREVRD 164
                     **************************8 PP

  == domain 2  score: -3.4 bits;  conditional E-value: 0.57
          DUF640  15 esqkrrdwnt 24 
                     e++kr+   t
  XP_010098512.1 175 EKKKRKKPTT 184
                     4444433222 PP



Or compare XP_010098512.1 to CDD or PaperBLAST