XP_015624971.1 has 248 amino acids
Query: DUF640 [M=126] Accession: PF04852.12 Description: Protein of unknown function (DUF640) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-70 219.9 0.0 6.9e-70 219.3 0.0 1.2 1 XP_015624971.1 Domain annotation for each sequence (and alignments): >> XP_015624971.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 219.3 0.0 6.9e-70 6.9e-70 5 126 .] 73 193 .. 69 193 .. 0.97 Alignments for each domain: == domain 1 score: 219.3 bits; conditional E-value: 6.9e-70 DUF640 5 askPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlraa 99 +s+P +lsryesqkrrdwntf +yl+++rPPl+l+rcsgahvlefl+y+dqfGktkvh++ c+fyG+++++apc cPlrqawGsldaliGrlraa XP_015624971.1 73 SSSP-SLSRYESQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLKYMDQFGKTKVHTPVCPFYGHPNPPAPCPCPLRQAWGSLDALIGRLRAA 166 4566.99**************************************************************************************** PP DUF640 100 feeeggkaeanPfaaravrlylrevrd 126 +ee+gg++e+nPf+aravrlylrevr+ XP_015624971.1 167 YEENGGTPEMNPFGARAVRLYLREVRE 193 *************************97 PP
Or compare XP_015624971.1 to CDD or PaperBLAST