PaperBLAST – Find papers about a protein or its homologs

 

Align XP_015624971.1 to PF04852 (DUF640)

XP_015624971.1 has 248 amino acids

Query:       DUF640  [M=126]
Accession:   PF04852.12
Description: Protein of unknown function (DUF640)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.6e-70  219.9   0.0    6.9e-70  219.3   0.0    1.2  1  XP_015624971.1  


Domain annotation for each sequence (and alignments):
>> XP_015624971.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  219.3   0.0   6.9e-70   6.9e-70       5     126 .]      73     193 ..      69     193 .. 0.97

  Alignments for each domain:
  == domain 1  score: 219.3 bits;  conditional E-value: 6.9e-70
          DUF640   5 askPkklsryesqkrrdwntfvrylkakrPPlelarcsgahvleflryldqfGktkvhaeacvfyGqaesaapckcPlrqawGsldaliGrlraa 99 
                     +s+P +lsryesqkrrdwntf +yl+++rPPl+l+rcsgahvlefl+y+dqfGktkvh++ c+fyG+++++apc cPlrqawGsldaliGrlraa
  XP_015624971.1  73 SSSP-SLSRYESQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLKYMDQFGKTKVHTPVCPFYGHPNPPAPCPCPLRQAWGSLDALIGRLRAA 166
                     4566.99**************************************************************************************** PP

          DUF640 100 feeeggkaeanPfaaravrlylrevrd 126
                     +ee+gg++e+nPf+aravrlylrevr+
  XP_015624971.1 167 YEENGGTPEMNPFGARAVRLYLREVRE 193
                     *************************97 PP



Or compare XP_015624971.1 to CDD or PaperBLAST