XP_015624971.1 has 248 amino acids
Query: ALOG_dom [M=126] Accession: PF04852.16 Description: ALOG domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-71 222.4 0.0 1.2e-70 221.8 0.0 1.2 1 XP_015624971.1 Domain annotation for each sequence (and alignments): >> XP_015624971.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 221.8 0.0 1.2e-70 1.2e-70 4 126 .] 72 193 .. 69 193 .. 0.97 Alignments for each domain: == domain 1 score: 221.8 bits; conditional E-value: 1.2e-70 ALOG_dom 4 seskPkalsryesqkrrdwntfvqylknkrPPlelarcsgahvleflryldqfGktkvhaeacvffGqaepaapckcPlrqawGsldaliGrlra 98 s+s+P +lsryesqkrrdwntf qyl+n+rPPl+l+rcsgahvlefl+y+dqfGktkvh++ c+f+G+++p+apc cPlrqawGsldaliGrlra XP_015624971.1 72 SSSSP-SLSRYESQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLKYMDQFGKTKVHTPVCPFYGHPNPPAPCPCPLRQAWGSLDALIGRLRA 165 45566.99*************************************************************************************** PP ALOG_dom 99 afeenggkaesnPfaaravrvylrevre 126 a+eengg++e+nPf+aravr+ylrevre XP_015624971.1 166 AYEENGGTPEMNPFGARAVRLYLREVRE 193 **************************97 PP
Or compare XP_015624971.1 to CDD or PaperBLAST