biolip::8p5qA has 129 amino acids
Query: ALOG_dom [M=126]
Accession: PF04852.16
Description: ALOG domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3e-70 220.5 0.1 3.4e-70 220.3 0.1 1.0 1 biolip::8p5qA
Domain annotation for each sequence (and alignments):
>> biolip::8p5qA
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 220.3 0.1 3.4e-70 3.4e-70 12 126 .] 2 116 .. 1 116 [. 0.99
Alignments for each domain:
== domain 1 score: 220.3 bits; conditional E-value: 3.4e-70
ALOG_dom 12 sryesqkrrdwntfvqylknkrPPlelarcsgahvleflryldqfGktkvhaeacvffGqaepaapckcPlrqawGsldaliGrlraafeenggka 107
srye+qkrrdwntf qyl+n+rPPl+l+rcsgahvleflryldqfGktkvh++ c f+G+++p+apc cPlrqawGsldaliGrlraafeenggk+
biolip::8p5qA 2 SRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTNICHFYGHPNPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKP 97
9*********************************************************************************************** PP
ALOG_dom 108 esnPfaaravrvylrevre 126
e+nPf+aravr+ylrevr+
biolip::8p5qA 98 ETNPFGARAVRLYLREVRD 116
******************8 PP
Or compare biolip::8p5qA to CDD or PaperBLAST