NP_001331590.1 has 471 amino acids
Query: DUF668 [M=89]
Accession: PF05003.16
Description: Protein of unknown function (DUF668)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.6e-37 112.0 1.6 5.5e-36 109.3 0.0 2.9 3 NP_001331590.1
Domain annotation for each sequence (and alignments):
>> NP_001331590.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? 0.3 0.0 0.056 0.056 28 60 .. 68 99 .. 53 113 .. 0.71
2 ? -3.0 0.1 0.58 0.58 51 79 .. 310 337 .. 305 343 .. 0.38
3 ! 109.3 0.0 5.5e-36 5.5e-36 1 89 [] 371 456 .. 371 456 .. 0.99
Alignments for each domain:
== domain 1 score: 0.3 bits; conditional E-value: 0.056
DUF668 28 veedarddLYqmLPasiraalrakLkslskkla 60
e++a d+ Y+++P+ +a +k++s + +++
NP_001331590.1 68 REREAEDNFYDGIPTYT-MAPSQKIRSAKSTQT 99
567899999*9999874.566777887777644 PP
== domain 2 score: -3.0 bits; conditional E-value: 0.58
DUF668 51 kLkslskkla...vdellaaeikeelekiLew 79
Lk+ +k + ++ l +++ e+++e
NP_001331590.1 310 ELKAQRKVVKslkKKSL----WSRGFEEVMEK 337
34433333222212333....33333333333 PP
== domain 3 score: 109.3 bits; conditional E-value: 5.5e-36
DUF668 1 tlGaagLalhYAnvivviekllsapslveedarddLYqmLPasiraalrakLkslskklavdellaaeikeelekiLewLvPlAhntir 89
+lG+agLalhYAn+iv+i++l+++ s+++++ard+LYq+LP+ i+ alr+k+ks++++ +el++++ik+e+e++L+wLvP+A nt++
NP_001331590.1 371 RLGPAGLALHYANIIVQIDTLVARASSITSNARDSLYQSLPPGIKLALRSKIKSFNVD---KELSVTQIKDEMERTLHWLVPVAGNTTK 456
79********************************************************...9*************************87 PP
Or compare NP_001331590.1 to CDD or PaperBLAST