VIMSS10109631 has 474 amino acids
Query: DUF668 [M=89]
Accession: PF05003.16
Description: Protein of unknown function (DUF668)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.1e-37 112.1 0.0 2.5e-36 110.3 0.0 2.0 1 VIMSS10109631
Domain annotation for each sequence (and alignments):
>> VIMSS10109631
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 110.3 0.0 2.5e-36 2.5e-36 1 89 [] 314 401 .. 314 401 .. 0.98
Alignments for each domain:
== domain 1 score: 110.3 bits; conditional E-value: 2.5e-36
DUF668 1 tlGaagLalhYAnvivviekllsapslveedarddLYqmLPasiraalrakLkslskklavdellaaeikeelekiLewLvPlAhntir 89
tlG+ag+alhYAn+ivv+ek++++p+lv+ darddLY+mLPas+r++lr++Lk + + a+d la+e+k++l +iL+wL PlA+n+ir
VIMSS10109631 314 TLGGAGVALHYANLIVVMEKMIKQPQLVGLDARDDLYSMLPASVRSSLRSRLKGVGFT-ATDGGLATEWKAALGRILRWLLPLAQNMIR 401
8********************************************************9.66**************************98 PP
Or compare VIMSS10109631 to CDD or PaperBLAST