CharProtDB::CH_019456 has 364 amino acids
Query: DUF676 [M=219]
Accession: PF05057.17
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-12 33.0 0.0 3.9e-12 32.3 0.0 1.2 1 CharProtDB::CH_019456
Domain annotation for each sequence (and alignments):
>> CharProtDB::CH_019456
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 32.3 0.0 3.9e-12 3.9e-12 8 102 .. 55 146 .. 54 173 .. 0.83
Alignments for each domain:
== domain 1 score: 32.3 bits; conditional E-value: 3.9e-12
DUF676 8 vVlvHGlqgnsaDlelikeqlekikeklpeekieflmsennesktfkgidvlgerlaeevlevvkkkkdknkkiSfvghSlGgliara 95
++lvHGl g + + + e+++ i+e+l+++ + + + ++ +g + ge+l+ +v v+ + + k+ +vghS+Ggl++r+
CharProtDB::CH_019456 55 IILVHGLSGTDK-YAGVVEYWYGIQEDLQQNGATVYVANLSGFQSDDGANGRGEQLLAYVKTVLAATGAT--KVNLVGHSQGGLTSRY 139
69*****99754.6778899***********99999999999*********************9999998..**************** PP
DUF676 96 aiaklke 102
+ a++ +
CharProtDB::CH_019456 140 VAAVAPD 146
9886663 PP
Or compare CharProtDB::CH_019456 to CDD or PaperBLAST