Q75NT4 has 364 amino acids
Query: DUF676 [M=219]
Accession: PF05057.17
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-11 30.3 0.0 2.6e-11 29.5 0.0 1.3 1 Q75NT4
Domain annotation for each sequence (and alignments):
>> Q75NT4
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 29.5 0.0 2.6e-11 2.6e-11 8 102 .. 55 146 .. 53 173 .. 0.83
Alignments for each domain:
== domain 1 score: 29.5 bits; conditional E-value: 2.6e-11
DUF676 8 vVlvHGlqgnsaDlelikeqlekikeklpeekieflmsennesktfkgidvlgerlaeevlevvkkkkdknkkiSfvghSlGgliaraaiaklke 102
++lvHGl g + + e+++ i+e+l+++ + + + ++ +g + ge+l+ +v v+ + k+ +vghS+Ggl++r++ a++ +
Q75NT4 55 IILVHGLTGTD-KYAGVLEYWYGIQEDLQQHGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGAA--KVNLVGHSQGGLTSRYVAAVAPD 146
79*******75.46778899***********99999999999*******************999998888..****************9886663 PP
Or compare Q75NT4 to CDD or PaperBLAST