SwissProt::P0DUB9 has 319 amino acids
Query: DUF676 [M=219]
Accession: PF05057.17
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.4e-12 33.0 0.0 3.9e-12 32.3 0.0 1.2 1 SwissProt::P0DUB9
Domain annotation for each sequence (and alignments):
>> SwissProt::P0DUB9
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 32.3 0.0 3.9e-12 3.9e-12 8 128 .. 11 116 .. 9 127 .. 0.84
Alignments for each domain:
== domain 1 score: 32.3 bits; conditional E-value: 3.9e-12
DUF676 8 vVlvHGlqgnsaDlelikeqlekikeklpeekieflmsennesktfkgidvlgerlaeevlevvkkkkdknkkiSfvghSlGgliaraaiak 99
v+lvHGl g + ++ + ++++ i+++l+ + + + + ++ +g + ge+l+ +v +v+ + + k+ ++ghS+Ggl++r++ a+
SwissProt::P0DUB9 11 VILVHGLAGT-DKFANVVDYWYGIQSDLQSHGAKVYVANLSGFQSDDGPNGRGEQLLAYVKQVLAATGAT--KVNLIGHSQGGLTSRYVAAV 99
8******996.56788889************9999999999999*********************99999..****************9886 PP
DUF676 100 lkekemtlkeaikglepvtfitlasPhLG 128
+ + +t+ +Ph G
SwissProt::P0DUB9 100 APQLV------------ASVTTIGTPHRG 116
65221............223455555555 PP
Or compare SwissProt::P0DUB9 to CDD or PaperBLAST