PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1074518 to PF05057 (DUF676)

VIMSS1074518 has 364 amino acids

Query:       DUF676  [M=219]
Accession:   PF05057.17
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.2e-12   33.1   0.0    3.6e-12   32.4   0.0    1.3  1  VIMSS1074518  


Domain annotation for each sequence (and alignments):
>> VIMSS1074518  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   32.4   0.0   3.6e-12   3.6e-12       8     129 ..      55     161 ..      52     181 .. 0.83

  Alignments for each domain:
  == domain 1  score: 32.4 bits;  conditional E-value: 3.6e-12
        DUF676   8 vVlvHGlqgnsaDlelikeqlekikeklpeekieflmsennesktfkgidvlgerlaeevlevvkkkkdknkkiSfvghSlGgliaraaiaklkeke 104
                   ++lvHGl g  +  + + e+++ i+e+l+ +   +   + +  ++ +g +  ge+l+ +v +v+ +   +  k+ ++ghS+Ggl++r++ a++ +  
  VIMSS1074518  55 IILVHGLTGTDK-YANVVEYWYGIQEDLQAHGATVYVANLSGFQSDDGPNGRGEQLLAYVQQVLAATGAS--KVNLIGHSQGGLTSRYVAAVAPQLV 148
                   79*******865.56677899999*******99999999999**********************999998..****************988665221 PP

        DUF676 105 mtlkeaikglepvtfitlasPhLGv 129
                                  +t+ +Ph G+
  VIMSS1074518 149 ------------ASVTTIGTPHRGS 161
                   ............2234555555555 PP



Or compare VIMSS1074518 to CDD or PaperBLAST