VIMSS5926848 has 364 amino acids
Query: DUF676 [M=219]
Accession: PF05057.17
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.9e-11 30.0 0.0 3.1e-11 29.3 0.0 1.2 1 VIMSS5926848
Domain annotation for each sequence (and alignments):
>> VIMSS5926848
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 29.3 0.0 3.1e-11 3.1e-11 8 102 .. 55 146 .. 53 173 .. 0.84
Alignments for each domain:
== domain 1 score: 29.3 bits; conditional E-value: 3.1e-11
DUF676 8 vVlvHGlqgnsaDlelikeqlekikeklpeekieflmsennesktfkgidvlgerlaeevlevvkkkkdknkkiSfvghSlGgliaraaiaklke 102
++lvHGl g + + ++++ i+e+l+++ + + + ++ +g + ge+l+ +v v+ + + k+ +vghS+Ggl++r++ a++ +
VIMSS5926848 55 IILVHGLTGTD-KYAGVLDYWYGIQEDLQQHGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGAT--KVNLVGHSQGGLTSRYVAAVAPD 146
79*******75.46778899***********99999999999*********************9999998..****************9886663 PP
Or compare VIMSS5926848 to CDD or PaperBLAST