VIMSS612493 has 155 amino acids
Query: DUF676 [M=217]
Accession: PF05057.18
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.2e-09 22.3 0.0 5.5e-09 21.9 0.0 1.1 1 VIMSS612493
Domain annotation for each sequence (and alignments):
>> VIMSS612493
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 21.9 0.0 5.5e-09 5.5e-09 8 99 .. 10 98 .. 5 114 .. 0.90
Alignments for each domain:
== domain 1 score: 21.9 bits; conditional E-value: 5.5e-09
DUF676 8 vVlvHGlegnsadleyvkeqlekkeklpdelivvlmsennesktfkgidvlgerlaeevlevvkkkkdkikkiSfvghSlGgliaryaigkl 99
vV +HG+ ++++ + + +++ e + +++ +l+ + + + g d+ e + v+e +++ k + k +vghSlG l+++++ +
VIMSS612493 10 VVAIHGITSSPTTWGGLVLAFNI-EGVIVHQLSLLGHGPIGIRRGVGTDYPLEAFTTDVIEQMDALKVD--KCALVGHSLGALVSSMVAQRQ 98
89************888888887.789999*************************************99..*************99876655 PP
Or compare VIMSS612493 to CDD or PaperBLAST