VIMSS834589 has 500 amino acids
Query: DUF676 [M=219]
Accession: PF05057.17
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.7e-09 23.6 0.0 3.8e-09 22.5 0.0 1.5 1 VIMSS834589
Domain annotation for each sequence (and alignments):
>> VIMSS834589
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 22.5 0.0 3.8e-09 3.8e-09 63 106 .. 143 186 .. 106 203 .. 0.76
Alignments for each domain:
== domain 1 score: 22.5 bits; conditional E-value: 3.8e-09
DUF676 63 laeevlevvkkkkdknkkiSfvghSlGgliaraaiaklkekemt 106
l+e + +v k k+k+k+i fvghSlGg a++a+ + k +
VIMSS834589 143 LLEFLEQVNKIIKNKHKRIIFVGHSLGGYLAQMALIYCDIKYKD 186
455555555556666899******************99988762 PP
Or compare VIMSS834589 to CDD or PaperBLAST