WP_001139636.1 has 447 amino acids
Query: DUF676 [M=219] Accession: PF05057.17 Description: Putative serine esterase (DUF676) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-12 31.5 0.1 1.7e-11 30.1 0.1 1.7 1 WP_001139636.1 Domain annotation for each sequence (and alignments): >> WP_001139636.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.1 0.1 1.7e-11 1.7e-11 6 132 .. 156 273 .. 152 283 .. 0.71 Alignments for each domain: == domain 1 score: 30.1 bits; conditional E-value: 1.7e-11 DUF676 6 hLvVlvHGlqgnsaDlelikeqlekikeklpeekieflmsennesktfkgidvlgerlaeevlevvkkkkdknkkiSfvghSlGgliaraaiakl 100 ++v+lvHGl n+ + ++++ i e+l ++ m + +t+ i g + + + v+++ + i ++ghS+Ggl++r+a+ + WP_001139636.1 156 RIVILVHGLCMNHLTWS--NAHYGGIGERLLAQRDHNTMLY-LNYNTGRRISANGRSFSNLLEDLVQRNPRI-TSIDLIGHSMGGLVSRSALFYG 246 69********9965553..3444444333333322222222.234588889999999999999999999988.79******************88 PP DUF676 101 kekemtlkeaikglepvtfitlasPhLGvlys 132 k++ m+ + i+ + +++ + sPh G + + WP_001139636.1 247 KQN-MY-Q-WIHMV--ENLVCIGSPHHGAVLE 273 844.43.3.44444..4899999***998765 PP
Or compare WP_001139636.1 to CDD or PaperBLAST