PaperBLAST – Find papers about a protein or its homologs

 

Align biolip::7cofA to PF05057 (DUF676)

biolip::7cofA has 320 amino acids

Query:       DUF676  [M=219]
Accession:   PF05057.17
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    4.7e-12   32.0   0.0    7.4e-12   31.3   0.0    1.2  1  biolip::7cofA  


Domain annotation for each sequence (and alignments):
>> biolip::7cofA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   31.3   0.0   7.4e-12   7.4e-12       8     128 ..      11     116 ..       9     136 .. 0.84

  Alignments for each domain:
  == domain 1  score: 31.3 bits;  conditional E-value: 7.4e-12
         DUF676   8 vVlvHGlqgnsaDlelikeqlekikeklpeekieflmsennesktfkgidvlgerlaeevlevvkkkkdknkkiSfvghSlGgliaraaiaklkek 103
                    +VlvHGl g     + + e+++ i+e+l+++   +   + +  ++ +g +  ge+l+ +v  v+ +   +  k+ +vghS+Ggl++r++ a++ + 
  biolip::7cofA  11 IVLVHGLTGTD-KYAGVLEYWYGIQEDLQQHGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGAT--KVNLVGHSQGGLTSRYVAAVAPDL 103
                    79*******75.46778899***********99999999999*********************9999998..****************98866633 PP

         DUF676 104 emtlkeaikglepvtfitlasPhLG 128
                                    +t+ +Ph G
  biolip::7cofA 104 VA------------SVTTIGTPHRG 116
                    22............23455555555 PP



Or compare biolip::7cofA to CDD or PaperBLAST