Q9D8Z2 has 76 amino acids
Query: UPF0203 [M=69] Accession: PF05254.16 Description: Uncharacterised protein family (UPF0203) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-31 92.4 0.5 9.5e-31 92.2 0.5 1.1 1 Q9D8Z2 Domain annotation for each sequence (and alignments): >> Q9D8Z2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.2 0.5 9.5e-31 9.5e-31 1 57 [. 2 58 .. 2 67 .. 0.95 Alignments for each domain: == domain 1 score: 92.2 bits; conditional E-value: 9.5e-31 UPF0203 1 aslapeCtelKekYdkCFnkWysekflkgkskeeeCeklfkeYqeCvqkalkekgie 57 +s+++ Ct++K++Yd+CFn+W++ekflkg+ + ++C++lfk+Yq+Cvqka+kek+i Q9D8Z2 2 NSVGEACTDMKREYDQCFNRWFAEKFLKGDGSGDPCTDLFKRYQQCVQKAIKEKEIP 58 699***************************************************997 PP
Or compare Q9D8Z2 to CDD or PaperBLAST