Q9D8Z2 has 76 amino acids
Query: UPF0203 [M=69]
Accession: PF05254.16
Description: Uncharacterised protein family (UPF0203)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.3e-31 92.4 0.5 9.5e-31 92.2 0.5 1.1 1 Q9D8Z2
Domain annotation for each sequence (and alignments):
>> Q9D8Z2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 92.2 0.5 9.5e-31 9.5e-31 1 57 [. 2 58 .. 2 67 .. 0.95
Alignments for each domain:
== domain 1 score: 92.2 bits; conditional E-value: 9.5e-31
UPF0203 1 aslapeCtelKekYdkCFnkWysekflkgkskeeeCeklfkeYqeCvqkalkekgie 57
+s+++ Ct++K++Yd+CFn+W++ekflkg+ + ++C++lfk+Yq+Cvqka+kek+i
Q9D8Z2 2 NSVGEACTDMKREYDQCFNRWFAEKFLKGDGSGDPCTDLFKRYQQCVQKAIKEKEIP 58
699***************************************************997 PP
Or compare Q9D8Z2 to CDD or PaperBLAST