NP_611283.1 has 253 amino acids
Query: DUF725 [M=121] Accession: PF05267.16 Description: Protein of unknown function (DUF725) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-39 118.6 17.5 1.4e-38 117.9 17.5 1.4 1 NP_611283.1 Domain annotation for each sequence (and alignments): >> NP_611283.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 117.9 17.5 1.4e-38 1.4e-38 2 120 .. 49 167 .. 48 168 .. 0.99 Alignments for each domain: == domain 1 score: 117.9 bits; conditional E-value: 1.4e-38 DUF725 2 skeCfeeYlpelnevaeqyeaeytkCestaeeereeidakveeereqlessakelcsalqkCdsitdsldafeCyakagsenlkilysisanAselaa 99 +++Cf+ Ylp+lneva++++++y++C+sta++e+++++a+++++++ ++ ++++lcsa+++C+s +d++++f+Cya+a++++++++y i++nA+++a+ NP_611283.1 49 TTQCFNLYLPMLNEVAATFSTSYQACISTANAETANLTAEADKQQKIYQAEVTSLCSAFTACNSDNDTTNFFKCYANAAESDVSVIYGIATNAASSAN 146 78************************************************************************************************ PP DUF725 100 slseeysaidtteeqCtnkae 120 sls ++ai++te+qCtn++e NP_611283.1 147 SLSTGIQAIQDTEYQCTNTTE 167 *******************98 PP
Or compare NP_611283.1 to CDD or PaperBLAST