NP_651699.1 has 211 amino acids
Query: DUF725 [M=121] Accession: PF05267.16 Description: Protein of unknown function (DUF725) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-39 120.6 2.0 2.6e-39 120.2 2.0 1.2 1 NP_651699.1 Domain annotation for each sequence (and alignments): >> NP_651699.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 120.2 2.0 2.6e-39 2.6e-39 2 121 .] 57 176 .. 56 176 .. 0.98 Alignments for each domain: == domain 1 score: 120.2 bits; conditional E-value: 2.6e-39 DUF725 2 skeCfeeYlpelnevaeqyeaeytkCestaeeereeidakveeereqlessakelcsalqkCdsitdsldafeCyakagsenlkilysisanAselaa 99 s+ Cf++Y+p++n +++qye +y+kC++++++++e + a ++++ ++ s ++ c+++ +C+si+d + afeC+a++g+e++ki+y++sanA+e+a NP_651699.1 57 SVRCFDYYIPIINGLSAQYELDYNKCVKDYDTASELVLAAWNSTLFGIQASGDRGCNTFFDCSSIVDFVLAFECFANVGAEQSKIMYQVSANATEAAV 154 689*********************************************************************************************** PP DUF725 100 slseeysaidtteeqCtnkaer 121 +++ +++++d+++e+C+n +e+ NP_651699.1 155 QIKIHLQTLDSQLESCLNYSEK 176 ******************9985 PP
Or compare NP_651699.1 to CDD or PaperBLAST