Q9CRB9 has 227 amino acids
Query: MIC19_MIC25 [M=168] Accession: PF05300.15 Description: MICOS complex subunit MIC19/MIC25 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-40 124.4 35.9 3.5e-38 117.8 33.9 2.7 2 Q9CRB9 Domain annotation for each sequence (and alignments): >> Q9CRB9 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 117.8 33.9 3.5e-38 3.5e-38 1 168 [] 29 174 .. 29 174 .. 0.85 2 ? -0.6 0.0 0.085 0.085 140 156 .. 184 200 .. 179 203 .. 0.88 Alignments for each domain: == domain 1 score: 117.8 bits; conditional E-value: 3.5e-38 MIC19_MIC25 1 SenVvnRmkessapakapspekpspssaageskapekeskppsaesssgrqpveeeelrkkikeellkrleqeqaivqe..elarlaerEreaaeesl 96 SenV++Rmkess++ + + s+ ss+ ++v++e+l+++++eel+ + ++++ q + ar +erEr+aa+e+l Q9CRB9 29 SENVIDRMKESSPSGS---K---SQ------------------RYSSVYGASVSDEDLKRRVAEELALEQAKKESEHQRrlKQARDLERERAAANEQL 102 8999999999997766...1...11..................1234566777789999999999977655555555551155788************ PP MIC19_MIC25 97 kkallrerasteqErqkakqlakqLeekeaeLkkqdaFYkEQlarLeeknaefykvtteqfhkAatkaeaki 168 ++a+lrer+s e+Er kak+la+qLeek++ ++kqdaFYkEQlarLee+++efykvtte+++kAa+++eak+ Q9CRB9 103 TRAVLRERISSEEERMKAKHLARQLEEKDRVMRKQDAFYKEQLARLEERSSEFYKVTTEEYQKAAEEVEAKF 174 **********************************************************************98 PP == domain 2 score: -0.6 bits; conditional E-value: 0.085 MIC19_MIC25 140 arLeeknaefykvtteq 156 a L+ k ++ y++ t+q Q9CRB9 184 ADLQTKILQCYRQNTQQ 200 78999********9998 PP
Or compare Q9CRB9 to CDD or PaperBLAST