P34466 has 1247 amino acids
Query: GSKIP_dom [M=105] Accession: PF05303.16 Description: GSKIP domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-13 35.2 0.0 1.5e-12 33.8 0.0 1.7 1 P34466 Domain annotation for each sequence (and alignments): >> P34466 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.8 0.0 1.5e-12 1.5e-12 30 102 .. 229 300 .. 224 303 .. 0.89 Alignments for each domain: == domain 1 score: 33.8 bits; conditional E-value: 1.5e-12 GSKIP_dom 30 evvylnvetkEgnelcielsakGfrivgskndtvkeksekedetkyyetlyaLLdkiSpkyrekFgekllekL 102 +v+y+ ++t E++ + + +++Gf + +s++ + + ++ ++++y+++ +LL+++Sp +++ + + l ++ P34466 229 DVLYIDITTVENRIYHVTCCTRGFYVNNSQDGRF-DPTVSNSNKTVYQSVIELLQNVSPGFKKVYPQILKRRQ 300 799*********************9877776666.999*************************9988877665 PP
Or compare P34466 to CDD or PaperBLAST