PaperBLAST – Find papers about a protein or its homologs

 

Align P34466 to PF05303 (GSKIP_dom)

P34466 has 1247 amino acids

Query:       GSKIP_dom  [M=105]
Accession:   PF05303.16
Description: GSKIP domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    5.8e-13   35.2   0.0    1.5e-12   33.8   0.0    1.7  1  P34466    


Domain annotation for each sequence (and alignments):
>> P34466  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.8   0.0   1.5e-12   1.5e-12      30     102 ..     229     300 ..     224     303 .. 0.89

  Alignments for each domain:
  == domain 1  score: 33.8 bits;  conditional E-value: 1.5e-12
  GSKIP_dom  30 evvylnvetkEgnelcielsakGfrivgskndtvkeksekedetkyyetlyaLLdkiSpkyrekFgekllekL 102
                +v+y+ ++t E++ + +  +++Gf + +s++    + + ++ ++++y+++ +LL+++Sp +++ + + l ++ 
     P34466 229 DVLYIDITTVENRIYHVTCCTRGFYVNNSQDGRF-DPTVSNSNKTVYQSVIELLQNVSPGFKKVYPQILKRRQ 300
                799*********************9877776666.999*************************9988877665 PP



Or compare P34466 to CDD or PaperBLAST