VIMSS5932567 has 122 amino acids
Query: DUF732 [M=72]
Accession: PF05305.18
Description: Protein of unknown function (DUF732)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.6e-12 33.4 0.0 4.6e-12 32.6 0.0 1.5 1 VIMSS5932567
Domain annotation for each sequence (and alignments):
>> VIMSS5932567
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 32.6 0.0 4.6e-12 4.6e-12 13 72 .] 47 105 .. 34 105 .. 0.85
Alignments for each domain:
== domain 1 score: 32.6 bits; conditional E-value: 4.6e-12
DUF732 13 GvtytdpdaaiaaGhqvCdaLdaGkspadvaaallasnpgltadqaaffvgaAiaayCPq 72
+ +++++ +ai+ Gh++C ++ G+s+a+v ++ ++ + ++ a ++v+ A++ +CP+
VIMSS5932567 47 HYDFPNN-DAIGYGHGICGKVSGGQSYAQVMGDVKNDVTPNDEFAANYLVSYAVNLLCPE 105
4577888.9****************************6666666666************7 PP
Or compare VIMSS5932567 to CDD or PaperBLAST