PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10094058 to PF05542 (DUF760)

VIMSS10094058 has 421 amino acids

Query:       DUF760  [M=83]
Accession:   PF05542.15
Description: Protein of unknown function (DUF760)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    2.1e-32   97.6   1.7    2.1e-24   72.1   1.9    3.4  2  VIMSS10094058  


Domain annotation for each sequence (and alignments):
>> VIMSS10094058  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   72.1   1.9   2.1e-24   2.1e-24       2      83 .]     150     274 ..     149     274 .. 0.94
   2 !   18.9   0.0   8.1e-08   8.1e-08       2      75 ..     328     410 ..     327     417 .. 0.90

  Alignments for each domain:
  == domain 1  score: 72.1 bits;  conditional E-value: 2.1e-24
         DUF760   2 Llryiqslkpee.vkal...........................................skpaspevleaikqtvsgllgllpsesfevtietsr 53 
                    L+r+i++lk++e ++ l                                           ++ +spe+ e+i++++  +lg++   + ++++++s+
  VIMSS10094058 150 LYRRIAELKENErRRTLeeilyalvvqkfmeanvslvpsvspssdpsgrvdtwptkveklERLHSPEMYEMIHNHLALILGSR-MGDLNSVAQISK 244
                    899999999999666669999999999999999999999999999999999999999999*********************99.77788******* PP

         DUF760  54 ekLaqLlassmmtGYfLrnaeqRleLeksl 83 
                     +++q++a+s+m+GYfL++++qR++Lek++
  VIMSS10094058 245 LRVGQVYAASVMYGYFLKRVDQRFQLEKTM 274
                    ****************************98 PP

  == domain 2  score: 18.9 bits;  conditional E-value: 8.1e-08
         DUF760   2 Llryiqslkpeevkalskpaspevleaikqtvsgllgl.........lpsesfevtietsrekLaqLlassmmtGYfLrnaeq 75 
                    L +y+ s + e++++ + + s e++ +i+++ ++l g+           ++s +++i++s   + +L + ++ +G fL+ +e 
  VIMSS10094058 328 LRSYVMSFDAETLQRYATIRSREAVGIIEKHTEALFGKpeivitpegTVDSSKDEQIKISFGGMKRLVLEAVTFGSFLWDVES 410
                    678***********************************9998877654566667*************************9996 PP



Or compare VIMSS10094058 to CDD or PaperBLAST