VIMSS12067 has 116 amino acids
Query: DUF760 [M=83]
Accession: PF05542.15
Description: Protein of unknown function (DUF760)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.1e-38 115.0 0.0 9.5e-38 114.8 0.0 1.1 1 VIMSS12067
Domain annotation for each sequence (and alignments):
>> VIMSS12067
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 114.8 0.0 9.5e-38 9.5e-38 1 82 [. 22 103 .. 22 104 .. 0.98
Alignments for each domain:
== domain 1 score: 114.8 bits; conditional E-value: 9.5e-38
DUF760 1 eLlryiqslkpeevkalskpaspevleaikqtvsgllgllpsesfevtietsrekLaqLlassmmtGYfLrnaeqRleLeks 82
+L+ y+q+l+pe++++ls+p s+ev++++++++ gllg+lp+e+f vti+tsre+L++Llas+mm+GYfLrnaeqRl +e+
VIMSS12067 22 SLWTYVQELSPETIAQLSRPDSQEVFQVMERNIIGLLGNLPPEHFGVTISTSRENLGRLLASAMMSGYFLRNAEQRLGFEQA 103
59****************************************************************************9986 PP
Or compare VIMSS12067 to CDD or PaperBLAST