VIMSS565954 has 112 amino acids
Query: DUF760 [M=83]
Accession: PF05542.15
Description: Protein of unknown function (DUF760)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9e-36 108.5 0.9 1e-35 108.3 0.9 1.1 1 VIMSS565954
Domain annotation for each sequence (and alignments):
>> VIMSS565954
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 108.3 0.9 1e-35 1e-35 1 83 [] 19 101 .. 19 101 .. 0.99
Alignments for each domain:
== domain 1 score: 108.3 bits; conditional E-value: 1e-35
DUF760 1 eLlryiqslkpeevkalskpaspevleaikqtvsgllgllpsesfevtietsrekLaqLlassmmtGYfLrnaeqRleLeksl 83
+L++y+q+++pe +++++k+as++++e+i+++v+gllg+lps++f+v i+ s++++a+Ll s+mmtGYfLr++eqR eLe++l
VIMSS565954 19 DLIQYLQKQSPEVMQRVAKSASEDIQEIIRHNVQGLLGMLPSDQFDVKITSSKDNIANLLSSAMMTGYFLRQMEQRKELEQTL 101
699*****************************************************************************987 PP
Or compare VIMSS565954 to CDD or PaperBLAST