A0A3Q7F690 has 308 amino acids
Query: DUF761 [M=36]
Accession: PF05553.15
Description: Cotton fibre expressed protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.5e-20 57.7 7.2 5.3e-20 57.1 7.2 1.3 1 A0A3Q7F690
Domain annotation for each sequence (and alignments):
>> A0A3Q7F690
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 57.1 7.2 5.3e-20 5.3e-20 2 36 .] 272 306 .. 271 306 .. 0.98
Alignments for each domain:
== domain 1 score: 57.1 bits; conditional E-value: 5.3e-20
DUF761 2 eevDakAEaFIakFreqlrLQRqeSikryqemlaR 36
+++++k+EaFI+kF+e++rLQRq+S+++y+em++R
A0A3Q7F690 272 DDLNRKVEAFIKKFNEDMRLQRQQSMQQYMEMINR 306
89********************************8 PP
Or compare A0A3Q7F690 to CDD or PaperBLAST