Q676U0 has 207 amino acids
Query: DUF761 [M=36]
Accession: PF05553.15
Description: Cotton fibre expressed protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.7e-20 57.0 4.8 1.3e-19 55.9 4.8 1.6 1 Q676U0
Domain annotation for each sequence (and alignments):
>> Q676U0
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 55.9 4.8 1.3e-19 1.3e-19 3 36 .] 171 204 .. 169 204 .. 0.96
Alignments for each domain:
== domain 1 score: 55.9 bits; conditional E-value: 1.3e-19
DUF761 3 evDakAEaFIakFreqlrLQRqeSikryqemlaR 36
+vD++A++FIakF+eqlrLQ +S+++yqeml R
Q676U0 171 QVDRRADEFIAKFYEQLRLQNRMSLLQYQEMLER 204
8*******************************98 PP
Or compare Q676U0 to CDD or PaperBLAST