VIMSS10084375 has 344 amino acids
Query: DUF761 [M=36]
Accession: PF05553.15
Description: Cotton fibre expressed protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.7e-19 53.0 5.0 1.5e-18 52.4 5.0 1.3 1 VIMSS10084375
Domain annotation for each sequence (and alignments):
>> VIMSS10084375
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 52.4 5.0 1.5e-18 1.5e-18 1 36 [] 307 342 .. 307 342 .. 0.95
Alignments for each domain:
== domain 1 score: 52.4 bits; conditional E-value: 1.5e-18
DUF761 1 deevDakAEaFIakFreqlrLQRqeSikryqemlaR 36
+ee+++++EaFI+kF+e+++LQR+eS+++y+e R
VIMSS10084375 307 QEELNRRVEAFIKKFNEEMKLQRMESLRQYKEITSR 342
79******************************8765 PP
Or compare VIMSS10084375 to CDD or PaperBLAST