VIMSS10084375 has 344 amino acids
Query: DUF761 [M=36] Accession: PF05553.15 Description: Cotton fibre expressed protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.7e-19 53.0 5.0 1.5e-18 52.4 5.0 1.3 1 VIMSS10084375 Domain annotation for each sequence (and alignments): >> VIMSS10084375 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 52.4 5.0 1.5e-18 1.5e-18 1 36 [] 307 342 .. 307 342 .. 0.95 Alignments for each domain: == domain 1 score: 52.4 bits; conditional E-value: 1.5e-18 DUF761 1 deevDakAEaFIakFreqlrLQRqeSikryqemlaR 36 +ee+++++EaFI+kF+e+++LQR+eS+++y+e R VIMSS10084375 307 QEELNRRVEAFIKKFNEEMKLQRMESLRQYKEITSR 342 79******************************8765 PP
Or compare VIMSS10084375 to CDD or PaperBLAST