VIMSS10102361 has 286 amino acids
Query: DUF761 [M=36]
Accession: PF05553.15
Description: Cotton fibre expressed protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.2e-19 55.1 1.4 2.2e-19 55.1 1.4 2.8 4 VIMSS10102361
Domain annotation for each sequence (and alignments):
>> VIMSS10102361
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -1.5 0.0 0.1 0.1 21 28 .. 102 109 .. 101 110 .. 0.87
2 ? -1.0 0.1 0.076 0.076 21 28 .. 162 169 .. 161 169 .. 0.89
3 ? -2.7 0.0 0.26 0.26 17 27 .. 235 245 .. 235 245 .. 0.83
4 ! 55.1 1.4 2.2e-19 2.2e-19 2 35 .. 251 284 .. 250 284 .. 0.96
Alignments for each domain:
== domain 1 score: -1.5 bits; conditional E-value: 0.1
DUF761 21 LQRqeSik 28
LQR Si+
VIMSS10102361 102 LQRVKSIN 109
9*****95 PP
== domain 2 score: -1.0 bits; conditional E-value: 0.076
DUF761 21 LQRqeSik 28
LQR Sik
VIMSS10102361 162 LQRVKSIK 169
9*****97 PP
== domain 3 score: -2.7 bits; conditional E-value: 0.26
DUF761 17 eqlrLQRqeSi 27
e +r +R Si
VIMSS10102361 235 ETMRVERTTSI 245
569****9887 PP
== domain 4 score: 55.1 bits; conditional E-value: 2.2e-19
DUF761 2 eevDakAEaFIakFreqlrLQRqeSikryqemla 35
e vD kA +FI+kF++ql+LQR++S++ry eml+
VIMSS10102361 251 EGVDDKASNFINKFKQQLKLQRLDSFLRYREMLK 284
78******************************97 PP
Or compare VIMSS10102361 to CDD or PaperBLAST