VIMSS10108067 has 182 amino acids
Query: DUF761 [M=36]
Accession: PF05553.15
Description: Cotton fibre expressed protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.4e-20 57.3 1.3 8.7e-20 56.4 1.3 1.5 1 VIMSS10108067
Domain annotation for each sequence (and alignments):
>> VIMSS10108067
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 56.4 1.3 8.7e-20 8.7e-20 3 33 .. 148 178 .. 146 179 .. 0.94
Alignments for each domain:
== domain 1 score: 56.4 bits; conditional E-value: 8.7e-20
DUF761 3 evDakAEaFIakFreqlrLQRqeSikryqem 33
vD +AE+FIakF+eq++LQRq+S+++y+e+
VIMSS10108067 148 GVDVRAEEFIAKFYEQMKLQRQISYLQYKEH 178
79***************************95 PP
Or compare VIMSS10108067 to CDD or PaperBLAST