VIMSS10109195 has 187 amino acids
Query: DUF761 [M=36]
Accession: PF05553.15
Description: Cotton fibre expressed protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-21 62.1 2.4 2.3e-21 61.4 2.4 1.3 1 VIMSS10109195
Domain annotation for each sequence (and alignments):
>> VIMSS10109195
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 61.4 2.4 2.3e-21 2.3e-21 1 36 [] 150 185 .. 150 185 .. 0.98
Alignments for each domain:
== domain 1 score: 61.4 bits; conditional E-value: 2.3e-21
DUF761 1 deevDakAEaFIakFreqlrLQRqeSikryqemlaR 36
++e+D+ A+ FI +F++q++LQ++ S+kryqemlaR
VIMSS10109195 150 EDEIDHVADLFISRFHKQMKLQKLLSFKRYQEMLAR 185
59*********************************8 PP
Or compare VIMSS10109195 to CDD or PaperBLAST