VIMSS10109942 has 326 amino acids
Query: DUF761 [M=36]
Accession: PF05553.15
Description: Cotton fibre expressed protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.2e-21 61.0 2.3 6e-21 60.1 2.3 1.5 1 VIMSS10109942
Domain annotation for each sequence (and alignments):
>> VIMSS10109942
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 60.1 2.3 6e-21 6e-21 1 35 [. 287 321 .. 287 322 .. 0.97
Alignments for each domain:
== domain 1 score: 60.1 bits; conditional E-value: 6e-21
DUF761 1 deevDakAEaFIakFreqlrLQRqeSikryqemla 35
+ee+++++EaFI+kF+e++rLQR+eS+ +y+em++
VIMSS10109942 287 QEELNRRVEAFIKKFNEEMRLQRLESLAKYNEMVN 321
79*******************************98 PP
Or compare VIMSS10109942 to CDD or PaperBLAST