XP_013685062.2 has 375 amino acids
Query: DUF761 [M=36] Accession: PF05553.15 Description: Cotton fibre expressed protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-21 60.3 0.6 1.6e-20 58.8 0.6 1.9 1 XP_013685062.2 Domain annotation for each sequence (and alignments): >> XP_013685062.2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.8 0.6 1.6e-20 1.6e-20 2 35 .. 340 373 .. 339 373 .. 0.96 Alignments for each domain: == domain 1 score: 58.8 bits; conditional E-value: 1.6e-20 DUF761 2 eevDakAEaFIakFreqlrLQRqeSikryqemla 35 + vDakA +FI+kF++ql+LQR++Si+ry+eml+ XP_013685062.2 340 DGVDAKASDFINKFKQQLKLQRLDSILRYKEMLK 373 89******************************97 PP
Or compare XP_013685062.2 to CDD or PaperBLAST