PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001333002.1 to PF05664 (DUF810)

NP_001333002.1 has 1046 amino acids

Query:       DUF810  [M=686]
Accession:   PF05664.11
Description: Plant family of unknown function (DUF810)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   1.7e-269  882.0   0.0     2e-269  881.8   0.0    1.1  1  NP_001333002.1  


Domain annotation for each sequence (and alignments):
>> NP_001333002.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  881.8   0.0    2e-269    2e-269       1     686 []      51     806 ..      51     806 .. 0.96

  Alignments for each domain:
  == domain 1  score: 881.8 bits;  conditional E-value: 2e-269
          DUF810   1 LsdddlretAYEillaacrssggk........altakskkke.esssaeaeaa.....rsltskaaskvkkalglkksksspsrr.......... 71 
                     Ls+++lre+AYE+++++cr+ gg+         l+++++  + + ++++ + +      +  + ++s++kkalglk+++ss+ +           
  NP_001333002.1  51 LSRAELREAAYEVFFMSCRAGGGRgggaggggGLNYYPAGGDgGGDGGSPTIGagprgGTGINVVSSRLKKALGLKARRSSQPTIlrssmnpssa 145
                     799*****************999999999999999999999833344444444999987777888**************999877999******* PP

          DUF810  72 ...................sarrpltsaeimrvqmevseqsdarlrktLlrilvgqvgrradtivlpLeLLrqlkksdFsdekeyeaWqkRqlki 147
                                        ++rrp+tsaeimr+qm+v eq+darlrktL+r+l+gqvg++adti+lpLeLLrqlk++dF+d  e+++Wq+Rqlk+
  NP_001333002.1 146 pgspgrmrgvrdqapgspgKPRRPMTSAEIMRQQMRVPEQTDARLRKTLMRALIGQVGKKADTIILPLELLRQLKPADFADGGEHHQWQRRQLKL 240
                     *********************************************************************************************** PP

          DUF810 148 LeagLllhpsvpldksntaakrlreiireaeekaietsknsevlrslrnavvsLasr..skdgiesetchWadgypLNvrLYekLLeavFDvrde 240
                     LeagL+ hps+pld+ n+ + r+rei++ a+ +ai+t+k s+++r++++av++La+r    +g+++e+chWadgypLNv LY +LL+a+FD+++e
  NP_001333002.1 241 LEAGLIHHPSLPLDRLNAPVLRFREIMQVADARAIDTGKASDTMRAICDAVLALAWRcaPGTGSPGEACHWADGYPLNVLLYVSLLQAIFDLKEE 335
                     *********************************************************73346789****************************** PP

          DUF810 241 tqvleevdellellkktWsiLGinqklHnvcfaWvLfqqyvvtgqvepdLleaalaqlkevakdakk.tkeeaylkllssvlasiqeWaekrLld 334
                     t+vl+evdellel+++ W++LGi++++HnvcfaWvLfqqyv+tgq+epdL  aal+ l +va+dak+ +++++y+++lssvl si++W+ekrLld
  NP_001333002.1 336 TVVLDEVDELLELMRRAWQTLGIDKMIHNVCFAWVLFQQYVATGQIEPDLAGAALTVLGDVAADAKQeHRDPVYTQVLSSVLGSIHDWSEKRLLD 430
                     *****************************************************************9989************************** PP

          DUF810 335 YHesFekg....niesmenvlslallaakilaedvsseerkakeeeaassesdsaservetYirsSikaafarvlekvdakske.....keekee 420
                     YHe + kg     +++m   lslal+++ki+ae+v+ +  + +++e+     ++a++rv++Y+r+S+++afa++le+   + ++     +++++e
  NP_001333002.1 431 YHEWYGKGmaatGAGAMVIPLSLALSTSKIIAESVPGMGIDLADSEHD-GIGSFAGNRVDHYVRCSMRNAFAKALENELGQGNSmviqrDDDPSE 524
                     *******988888899*********************99777764343.34569***********************9999888999999***** PP

          DUF810 421 vLalLAketkelaekekevfspvLkrwhplaaavaavtLhklYgkeLkqflegvssltedvveVLqaAdkLekalvqlavedsadsedggkslvr 515
                     ++a LAk+t++la+ e e fspvLkrwhp+++a a++tLh++Yg  Lkq+++++++lt+++v+VL+aA++Lekalv ++ved ads+dgg+slvr
  NP_001333002.1 525 TMARLAKDTEQLAQFELENFSPVLKRWHPFPGASAVATLHSCYGVLLKQYVAKATCLTNELVHVLHAAGRLEKALVPMMVEDVADSDDGGRSLVR 619
                     *********************************************************************************************** PP

          DUF810 516 emkpYevesvianlvkkWvkerlkklkewveraleqEtWePkskqeryaqSavellriieetvdeffelpvpmkeellqdLldgldkllqeYlsk 610
                     e++pY+v+s++a+++++W++erl+ ++e++ r++++E+W Pksk e+ya+Savel++++++tvdeff++pv+++++++q+++dgl +++qeY+s+
  NP_001333002.1 620 EVVPYDVDSLVARFLRTWIEERLRVARECLLRSKDTESWIPKSKGEPYARSAVELMKLAKATVDEFFGIPVTARDDMVQNVADGLGAIVQEYISF 714
                     *********************************************************************************************** PP

          DUF810 611 vasslgskeslvPslPaLTRckedsklkklwkkkavepclld...................ekrksklnslgtqkLcvrLNTLhyllsqleslek 686
                     +a s+g+k+s++P+lP+LTRc++ds++++lwk++a++++++                    ++r+s+  s+gtq+L++rLNTLhylls++++l+k
  NP_001333002.1 715 LA-SCGTKQSYLPPLPPLTRCNQDSTIIRLWKRAATPCREAGtnprgrahhgqsesisggnNPRPST--SRGTQRLYIRLNTLHYLLSHIQALDK 806
                     **.********************************5555544889***************99*****..************************97 PP



Or compare NP_001333002.1 to CDD or PaperBLAST