PaperBLAST – Find papers about a protein or its homologs

 

Align NP_196314.2 to PF05664 (DUF810)

NP_196314.2 has 1101 amino acids

Query:       DUF810  [M=686]
Accession:   PF05664.11
Description: Plant family of unknown function (DUF810)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   1.3e-243  796.5   2.5   1.6e-243  796.2   2.5    1.1  1  NP_196314.2  


Domain annotation for each sequence (and alignments):
>> NP_196314.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  796.2   2.5  1.6e-243  1.6e-243       1     686 []     195     865 ..     195     865 .. 0.96

  Alignments for each domain:
  == domain 1  score: 796.2 bits;  conditional E-value: 1.6e-243
       DUF810   1 LsdddlretAYEillaacrssggkaltakskkkeesssaeaeaarsltskaaskvkkalglkksksspsrrsarrpltsa.eimrvqmevseqsdarl 97 
                  ++dddlretA+Eilla++ +sgg+++++k+kkke               k +s+++k+lg+k+++ s+s+ s++  +    e+mr qme+se++d r+
  NP_196314.2 195 ITDDDLRETAFEILLACAGASGGLIVPSKEKKKE---------------KSRSRLIKKLGRKSESVSQSQ-SSSGLVS-LlEMMRGQMEISEAMDIRT 275
                  689**************************99999...............779**********99888774.4444444.36***************** PP

       DUF810  98 rktLlrilvgqvgrradtivlpLeLLrqlkksdFsdekeyeaWqkRqlkiLeagLllhpsvpldksntaa...krlreiireaee..kaietsknsev 190
                  r++Ll++l+g+vg+r+d++++pLeLL+++++++Fsd+k+y +WqkRql++L +gL+++p+v +++s ++a   k+l+  i+e+e+  +++ + +++e+
  NP_196314.2 276 RQGLLNALAGKVGKRMDSLLVPLELLCCVSRTEFSDKKAYLRWQKRQLNMLAEGLINNPVVGFGESGRKAtdlKSLLLRIEESESlpSSAGEVQRAEC 373
                  ******************************************************************999977778888899999988889999***** PP

       DUF810 191 lrslrnavvsLasr.skdgiesetchWadgypLNvrLYekLLeavFDvrdetqvleevdellellkktWsiLGinqklHnvcfaWvLfqqyvvtgqve 287
                  l+slr++++sLa+r +++++++e+chWadgy+LNvrLYekLL +vFD++++++++eev+e+lellk+tW++LGi++++H +c+aWvLf+qyv+t+  e
  NP_196314.2 374 LKSLREVAISLAERpARGDLTGEVCHWADGYHLNVRLYEKLLLCVFDILNDGKLTEEVEEILELLKSTWRVLGITETIHYTCYAWVLFRQYVITS--E 469
                  ***********************************************************************************************..* PP

       DUF810 288 pdLleaalaqlkevak.dakktkeeaylk............llssvlasiqeWaekrLldYHesFekgniesmenvlslallaakilaedvsseerka 372
                    Ll++a++qlk++   +++  +e+++lk            +l+s+l+ i++Wa+k+L dYH++F++  +  me+++++a+++ ++l e+        
  NP_196314.2 470 RGLLRHAIQQLKKIPLkEQRGPQERLHLKtlkcrvdneeisFLESFLSPIRSWADKQLGDYHLHFAE-GSLVMEDTVTVAMITWRLLLEE-------- 558
                  ***************988888**********************************************.8899***************992........ PP

       DUF810 373 keeeaassesdsaservetYirsSikaafarvlekvdakskekeekeevLalLAketkelaekekevfspvLkrwhplaaavaavtLhklYgkeLkqf 470
                   + + a+++++s++e++e+Y+ sSik++f+r+  ++d +   ++++e+ LalLA+etk+l++k++++f+p+L+++hp+a+a +a+++hklYg++Lk+f
  NP_196314.2 559 -S-DRAMHSNSSDREQIESYVLSSIKNTFTRMSLAIDRS---DRNNEHHLALLAEETKKLMKKDSTIFMPILSQRHPQAIAFSASLIHKLYGNKLKPF 651
                  .1.2334456699*******************9988888...699***************************************************** PP

       DUF810 471 legvssltedvveVLqaAdkLekalvqlavedsadsedggkslvremkpYevesvianlvkkWvkerlkklkewveraleqEtWePkskqeryaqSav 568
                  l+g+++lted+v+V++aAd+Le++l++l++  s++ ed++  +++++ pYeves++ +lv++W++++l +++ wvera +qE+W+P s q+ry++S+v
  NP_196314.2 652 LDGAEHLTEDAVSVFPAADSLEQYLLELMT--SVCGEDTSGPYFKKLIPYEVESLSGTLVLRWINSQLGRILSWVERAYKQEHWDPISPQQRYGSSIV 747
                  ******************************..****************************************************************** PP

       DUF810 569 ellriieetvdeffelpvpmkeellqdLldgldkllqeYlskvasslgskeslvPslPaLTRckedsklkklwkkkavepclldekrksklnslgtqk 666
                  e++ri+eetvd+ff l+vpm++ +l++L++g+d+++q Y+++v+++l+sk++lvP++P+LTR+k+++ +k ++kk+++++++lde+r+ +++  +t  
  NP_196314.2 748 EVFRIVEETVDQFFALKVPMRSIELSALFRGIDNAFQVYTNHVMEKLASKDDLVPPVPVLTRYKKETAIKVFVKKELFDSKHLDERRSINIDVPATAM 845
                  ************************************************************************************************** PP

       DUF810 667 LcvrLNTLhyllsqleslek 686
                  Lcv+LNTLhy  sql++le+
  NP_196314.2 846 LCVQLNTLHYAVSQLSKLED 865
                  ******************96 PP



Or compare NP_196314.2 to CDD or PaperBLAST