PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10078583 to PF05664 (DUF810)

VIMSS10078583 has 1035 amino acids

Query:       DUF810  [M=686]
Accession:   PF05664.11
Description: Plant family of unknown function (DUF810)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
     6e-290  949.7   0.0   7.6e-290  949.3   0.0    1.1  1  VIMSS10078583  


Domain annotation for each sequence (and alignments):
>> VIMSS10078583  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  949.3   0.0  7.6e-290  7.6e-290       1     686 []      34     794 ..      34     794 .. 0.97

  Alignments for each domain:
  == domain 1  score: 949.3 bits;  conditional E-value: 7.6e-290
         DUF810   1 LsdddlretAYEillaacrssggk....altakskkkeesssaeaeaa.................rsltskaaskvkkalglkksksspsrr.... 71 
                    L++d++retAYEi++aacrss+g+    alt++sk++++++++++  +                 +++ ++ +s+vk+alglk+ k+spsrr    
  VIMSS10078583  34 LDRDEIRETAYEIFFAACRSSPGFggrnALTFYSKHNAGDHQGDGIGGgggsgssngsgfgslgrKEVLTTPTSRVKRALGLKMLKRSPSRRmstv 129
                    789********************99999999999999988887776668999************98889999******************99**** PP

         DUF810  72 ......................................sarrpltsaeimrvqmevseqsdarlrktLlrilvgqvgrradtivlpLeLLrqlkks 129
                                                          ++rrpltsaeimr+qm+v+eqsd+rlrktL+r+lvgq+grra+ti+lpLeLLr++k+s
  VIMSS10078583 130 gtvvgavsapsspgnngsigsgsghfspgagfftvppaRPRRPLTSAEIMRQQMKVTEQSDTRLRKTLMRTLVGQTGRRAETIILPLELLRHVKPS 225
                    ************************************************************************************************ PP

         DUF810 130 dFsdekeyeaWqkRqlkiLeagLllhpsvpldksntaakrlreiireaeekaietsknsevlrslrnavvsLasrskdgiesetchWadgypLNvr 225
                    +F d +ey+ Wq+Rqlk+LeagLl+hps+pl+k+n++a+rlreiir++e+kai+tskns+ + +l+n+v sL++r+++  ++++chWadgypLN++
  VIMSS10078583 226 EFGDVHEYQIWQRRQLKVLEAGLLIHPSIPLEKTNNFAMRLREIIRQSETKAIDTSKNSDIMPTLCNLVASLSWRNATP-TTDICHWADGYPLNIH 320
                    ***************************************************************************6555.69************** PP

         DUF810 226 LYekLLeavFDvrdetqvleevdellellkktWsiLGinqklHnvcfaWvLfqqyvvtgqvepdLleaalaqlkevakdakk.tkeeaylkllssv 320
                    LY +LL+++FD+rdet vl+e+dellel+kktW +LGi++ +Hn+cf+WvLf+qy+vt+q+epdLl a++a+l+eva+dakk ++e++y+kll+s+
  VIMSS10078583 321 LYVALLQSIFDIRDETLVLDEIDELLELMKKTWIMLGITRAIHNLCFTWVLFHQYIVTSQMEPDLLGASHAMLAEVANDAKKsDREALYVKLLTST 416
                    ******************************************************************************999999************ PP

         DUF810 321 lasiqeWaekrLldYHesFekgniesmenvlslallaakilaedvsseerkakeeeaassesdsaservetYirsSikaafarvlekvdakske.. 414
                    las+q+W+ekrLl+YH++F++gn++ +en+l+lal+++kil edv+ ++++  e+ +++  +ds+++rv++Yir+Sik+af++v+e+++a+ +e  
  VIMSS10078583 417 LASMQGWTEKRLLSYHDYFQRGNVGLIENLLPLALSSSKILGEDVTISQMNGLEKGDVK-LVDSSGDRVDYYIRASIKNAFSKVIENMKAEIEEte 511
                    ************************************************98888754444.578***************************988888 PP

         DUF810 415 ..keekeevLalLAketkelaekekevfspvLkrwhplaaavaavtLhklYgkeLkqflegvssltedvveVLqaAdkLekalvqlavedsadsed 508
                      +ee++ +L+ LAket++la +e+e+fsp+Lkrwh +aa+va v Lh++Yg+ L q+l+g s++t+++veVLq+A+kLek+lvq+++e+s ++ed
  VIMSS10078583 512 egEEEAATMLLRLAKETEDLALRESECFSPILKRWHLVAAGVASVSLHQCYGSILMQYLAGRSTITKETVEVLQTAGKLEKVLVQMVAENSDECED 607
                    999999****************************************************************************************** PP

         DUF810 509 ggkslvremkpYevesvianlvkkWvkerlkklkewveraleqEtWePkskqeryaqSavellriieetvdeffelpvpmkeellqdLldgldkll 604
                    ggk lvrem+pYev+s+i +l+++W++e+l++++e+++ra+e EtW+Pksk+e+yaqSa el++++++ ++effe+p+ ++e+l++dL++gl+kl+
  VIMSS10078583 608 GGKGLVREMVPYEVDSIILRLLRQWIEEKLQTVQECLSRAKEAETWNPKSKSEPYAQSAGELMKLANDAIEEFFEIPIGITEDLVHDLAEGLEKLF 703
                    ************************************************************************************************ PP

         DUF810 605 qeYlskvasslgskeslvPslPaLTRckedsklkklwkkkavepclld..............ekrksklnslgtqkLcvrLNTLhyllsqleslek 686
                    qeY+++va s+gsk+s++P+lP+LTRc++dsk++klwkk++  pc ++              ++r+s+  s+gtq+L++rLNTLh+l sql+sl+k
  VIMSS10078583 704 QEYTTFVA-SCGSKQSYIPTLPPLTRCNRDSKFVKLWKKAT--PCAASgeelnqmgeapggnHPRPST--SRGTQRLYIRLNTLHFLSSQLHSLNK 794
                    ********.********************************..6664446899***************..************************86 PP



Or compare VIMSS10078583 to CDD or PaperBLAST