PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10088827 to PF05664 (DUF810)

VIMSS10088827 has 952 amino acids

Query:       DUF810  [M=686]
Accession:   PF05664.11
Description: Plant family of unknown function (DUF810)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
   1.2e-271  889.2   0.0   1.5e-271  888.9   0.0    1.0  1  VIMSS10088827  


Domain annotation for each sequence (and alignments):
>> VIMSS10088827  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  888.9   0.0  1.5e-271  1.5e-271       1     683 [.      15     717 ..      15     718 .. 0.96

  Alignments for each domain:
  == domain 1  score: 888.9 bits;  conditional E-value: 1.5e-271
         DUF810   1 LsdddlretAYEillaacrssggkaltakskkkeesssaeaeaa.........rsltskaaskvkkalglkksksspsrr.........sarrplt 78 
                    Ls+++lretAYEil+aacrs+g+++lt+++++ ++++s++ ++a         rslts+aaskvkkalg+kk+  +             ++++++t
  VIMSS10088827  15 LSNSELRETAYEILVAACRSTGSRPLTYIPQSPKSDRSNGLTTAslspspslhRSLTSTAASKVKKALGMKKRIGDGDGGagesssqpdRSKKSVT 110
                    799*****************************997777777666899************************99885544456666667799***** PP

         DUF810  79 saeimrvqmevseqsdarlrktLlrilvgqvgrradtivlpLeLLrqlkksdFsdekeyeaWqkRqlkiLeagLllhpsvpldksntaakrlreii 174
                    ++e++rvqm++seq+d+r+r++Llri++gq+grr++++vlpLeLL+qlk+sdF+d++eye+Wq+R+lk+LeagL+l+p+vpl+ks++++++l++ii
  VIMSS10088827 111 VGELVRVQMRISEQIDSRIRRALLRIASGQLGRRVEMMVLPLELLQQLKASDFPDQEEYESWQRRNLKLLEAGLILYPCVPLSKSDKSVQQLKQII 206
                    ************************************************************************************************ PP

         DUF810 175 reaeekaietsknsevlrslrnavvsLasr.skdgiesetchWadgypLNvrLYekLLeavFDvrdetqvleevdellellkktWsiLGinqklHn 269
                    r+  e++++t+k +   ++lr++v+sLasr +++gi setchWadg+pLN+r+Y++LLe++FDv+de  ++eevde+lel+kktW++LGinq++Hn
  VIMSS10088827 207 RSGLERPLDTGKITGETQNLRSLVMSLASRqNNNGIGSETCHWADGFPLNLRIYQMLLESCFDVNDELLIVEEVDEVLELIKKTWPVLGINQMIHN 302
                    ******************************99**************************************************************** PP

         DUF810 270 vcfaWvLfqqyvvtgqvepdLleaalaqlkevakdakktkeeaylkllssvlasiqeWaekrLldYHesFekgniesmenvlslallaakilaedv 365
                    vcf WvL ++yv tgqve+dLl aa++ + e+++da +t++++y+k+lssvl+ +++W ekrLl+YH++F+ +n+e++e+++sl +l+ak+l ed+
  VIMSS10088827 303 VCFLWVLVNRYVSTGQVENDLLVAAHNLILEIENDAMETNDPEYSKILSSVLSLVMDWGEKRLLAYHDTFNIDNVETLETTVSLGILVAKVLGEDI 398
                    ************************************************************************************************ PP

         DUF810 366 sseerkakeeeaassesdsaservetYirsSikaafarvlekvdakske....keekeevLalLAketkelaekekevfspvLkrwhplaaavaav 457
                    sse+r++k+      ++ds ++rv+tYirsS++ af+++ + v+ ++k+    ++++ ++La+LA+++ +la +ek++fsp+Lk+whplaa+vaa+
  VIMSS10088827 399 SSEYRRKKK------HVDSGRDRVDTYIRSSLRMAFQQTKRMVEHSKKSksrqSTNNLPALAILAEDIGHLAFNEKAIFSPILKNWHPLAAGVAAA 488
                    ****88776......57799****************997666665555555679999*************************************** PP

         DUF810 458 tLhklYgkeLkqflegvssltedvveVLqaAdkLekalvqlavedsadsedggkslvremkpYevesvianlvkkWvkerlkklkewveraleqEt 553
                    tLh++Yg+eLk+f++g+++lt+d+++VL+aAdkLek+lvq+av+d++dsedggks++rem+p+e+e vi nlvk+W+k r+++lkew++r+l+qE 
  VIMSS10088827 489 TLHSCYGTELKKFVSGITELTPDAIRVLTAADKLEKDLVQIAVQDAVDSEDGGKSVIREMPPFEAEVVIGNLVKSWIKIRVDRLKEWIDRNLQQEV 584
                    ************************************************************************************************ PP

         DUF810 554 WePkskqeryaqSavellriieetvdeffelpvpmkeellqdLldgldkllqeYlskvasslgskeslvPslPaLTRckedsklkklwkkkavepc 649
                    W+P+s++   a+Sav++lr+++et+++ff lp+ +++ ll++L++gldk++q+Y+sk++ss+gs+++++P lPaLTRc+ +s+l+ ++kkk+ +p+
  VIMSS10088827 585 WNPRSNKLGIAPSAVDVLRMVDETLEAFFLLPILLHPVLLPELTSGLDKCMQHYVSKAKSSCGSRNTFLPVLPALTRCTVGSRLHGVFKKKE-KPM 679
                    ********************************************************************************************.566 PP

         DUF810 650 lldekrkskln....slgtqkLcvrLNTLhyllsqles 683
                    +++++rks+l     s ++ ++c+r+NTL+y+++++es
  VIMSS10088827 680 VASHRRKSQLGtgndSAEILQFCCRINTLQYIRTEIES 717
                    6699*****999999********************985 PP



Or compare VIMSS10088827 to CDD or PaperBLAST