PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10089535 to PF05664 (DUF810)

VIMSS10089535 has 987 amino acids

Query:       DUF810  [M=686]
Accession:   PF05664.11
Description: Plant family of unknown function (DUF810)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
   2.2e-279  914.8   0.0   2.5e-279  914.5   0.0    1.0  1  VIMSS10089535  


Domain annotation for each sequence (and alignments):
>> VIMSS10089535  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  914.5   0.0  2.5e-279  2.5e-279       1     686 []      49     751 ..      49     751 .. 0.95

  Alignments for each domain:
  == domain 1  score: 914.5 bits;  conditional E-value: 2.5e-279
         DUF810   1 LsdddlretAYEillaacrssggkaltakskkke.esssaeaeaa.....rsltskaaskvkkalglkksksspsrr............sarrplt 78 
                    Lsd+dlr tAYEi++aacrs++gk+l++  + +  +++s +++ a     rslts+aask+kkalgl++s+s +  +            +++rp+t
  VIMSS10089535  49 LSDSDLRLTAYEIFVAACRSATGKPLSSAVSVAVlNQDSPNGSPAspaiqRSLTSTAASKMKKALGLRSSSSLSPGSnkssgsasgsngKSKRPTT 144
                    89**********************66665554442333333322245566******************999854444577789999999******* PP

         DUF810  79 saeimrvqmevseqsdarlrktLlrilvgqvgrradtivlpLeLLrqlkksdFsdekeyeaWqkRqlkiLeagLllhpsvpldksntaakrlreii 174
                    ++e+mr qm+vse+ d+r+r+++lri+++qvgr+++++vlpLeLL+qlk+sdF+d++ey aW kR lk+LeagLllhp vpldk+n++ +rlr+ii
  VIMSS10089535 145 VGELMRIQMRVSEAVDSRVRRAFLRIAASQVGRKIESVVLPLELLQQLKSSDFTDQQEYDAWLKRSLKVLEAGLLLHPRVPLDKTNSS-QRLRQII 239
                    **************************************************************************************99.******* PP

         DUF810 175 reaeekaietsknsevlrslrnavvsLasrskdgiesetchWadgypLNvrLYekLLeavFDvrdetqvleevdellellkktWsiLGinqklHnv 270
                    + a ++++et++n+e+++slr+av+sLa+rs dg+ s++chWadg p+N+rLYe LLea+FD +d t+++eevd+l+e++kktW iLGinq+lHn+
  VIMSS10089535 240 HGALDRPLETGRNNEQMQSLRSAVMSLATRS-DGSFSDSCHWADGSPFNLRLYELLLEACFDSNDATSMVEEVDDLMEHIKKTWVILGINQMLHNL 334
                    ******************************5.6778************************************************************ PP

         DUF810 271 cfaWvLfqqyvvtgqvepdLleaalaqlkevakdakktkeeaylkllssvlasiqeWaekrLldYHesFekgniesmenvlslallaakilaedvs 366
                    cf+W+Lf++yvvtgqve+dLl+a+ +ql+evakdak+tk+++y+++lss+l++i +WaekrLl+YH++F++gni++me ++sl ++aa+il+ed+s
  VIMSS10089535 335 CFTWLLFSRYVVTGQVEMDLLHACDSQLAEVAKDAKTTKDPEYSQVLSSTLSAILGWAEKRLLAYHDTFDRGNIHTMEGIVSLGVSAARILVEDIS 430
                    ************************************************************************************************ PP

         DUF810 367 seerkakeeeaassesdsaservetYirsSikaafarvlekvdakske...keekeevLalLAketkelaekekevfspvLkrwhplaaavaavtL 459
                    +e+r++++      e+d+a++r+etYirsS++++fa+ +ek+d+++++   ++++ +vLa+LAk++ ela +ek++fsp+Lkrwhp+aa+va++tL
  VIMSS10089535 431 NEYRRRRK-----GEVDVARTRIETYIRSSLRTSFAQRMEKADSSRRAsrnQKNPLPVLAILAKDIGELAIQEKRMFSPILKRWHPFAAGVAVATL 521
                    ***77665.....3688****************************988899999****************************************** PP

         DUF810 460 hklYgkeLkqflegvssltedvveVLqaAdkLekalvqlavedsadsedggkslvremkpYevesvianlvkkWvkerlkklkewveraleqEtWe 555
                    h +Yg+e+kqf++g+s+lt+d+v++L+aAdkLek+lvq+aveds+ds+dggk+++rem+p+e+e+vianlvk+W+k+r+++lkewv+r+l+qE W+
  VIMSS10089535 522 HVCYGNEIKQFIAGISELTPDAVQILRAADKLEKDLVQIAVEDSVDSDDGGKAIIREMPPFEAETVIANLVKDWIKARIDRLKEWVDRNLQQEVWK 617
                    ************************************************************************************************ PP

         DUF810 556 Pksk.qeryaqSavellriieetvdeffelpvpmkeellqdLldgldkllqeYlskvasslgskeslvPslPaLTRckedsklkklwkkkavepcl 650
                    P+++ +  yaqSa+e+lri++et+++ff+lp+pm++++l+dL+ gldk lq+Y+sk++s +gs+++++P++PaLTRc+++sk+   wkkk+++p++
  VIMSS10089535 618 PLENlEGGYAQSAAEVLRITDETLEAFFQLPIPMHPAVLPDLIIGLDKYLQYYVSKAKSGCGSRTTYMPTMPALTRCTTGSKF--QWKKKEKTPTT 711
                    ***95558**************************************************************************9..59*99988888 PP

         DUF810 651 ldekrkskln......slgtqkLcvrLNTLhyllsqleslek 686
                      +kr+s+++      s+g++++cvr+N+Lh ++s+l+++ek
  VIMSS10089535 712 --QKRESQVSvmngenSFGVTQICVRINSLHKIRSELDVVEK 751
                    ..78888887778999***********************997 PP



Or compare VIMSS10089535 to CDD or PaperBLAST