PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10090404 to PF05664 (DUF810)

VIMSS10090404 has 1039 amino acids

Query:       DUF810  [M=686]
Accession:   PF05664.11
Description: Plant family of unknown function (DUF810)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
   2.1e-295  967.7   0.0   2.5e-295  967.4   0.0    1.1  1  VIMSS10090404  


Domain annotation for each sequence (and alignments):
>> VIMSS10090404  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  967.4   0.0  2.5e-295  2.5e-295       1     686 []      39     797 ..      39     797 .. 0.97

  Alignments for each domain:
  == domain 1  score: 967.4 bits;  conditional E-value: 2.5e-295
         DUF810   1 LsdddlretAYEillaacrssggk....altakskkkeesssaeaeaa..................rsltskaaskvkkalglkksksspsrr... 71 
                    L++dd+retAYEi+++acrss+g+    alt++s+++++++++++  +                  ++++++ +s+vk+alglk+ k+spsrr   
  VIMSS10090404  39 LDRDDIRETAYEIFFTACRSSPGFggrtALTFYSNHNSNDHHGDGGGGigsggstgvgsgfgssgrKEVVTTPTSRVKRALGLKMLKRSPSRRmst 134
                    789********************99999999999999977777776668899*************98999999******************99*** PP

         DUF810  72 ...................................sarrpltsaeimrvqmevseqsdarlrktLlrilvgqvgrradtivlpLeLLrqlkksdFs 132
                                                       ++rrpltsaeimr+qm+v+eqsd+rlrktLlr+lvgq+grra+ti+lpLeLLr+lk+s+F 
  VIMSS10090404 135 igaaggaatslspggmnssaghispgagfltvqpsRPRRPLTSAEIMRQQMKVTEQSDSRLRKTLLRTLVGQTGRRAETIILPLELLRHLKTSEFG 230
                    ************************************************************************************************ PP

         DUF810 133 dekeyeaWqkRqlkiLeagLllhpsvpldksntaakrlreiireaeekaietsknsevlrslrnavvsLasrskdgiesetchWadgypLNvrLYe 228
                    d +ey+ Wq+Rqlk+LeagLllhps+pldk+n++a+rlre++r++e+k+i+tsk+s+++r+l+n+vvsL++r+++g ++++chWadgypLN++LY 
  VIMSS10090404 231 DIHEYQLWQRRQLKVLEAGLLLHPSIPLDKTNNFAMRLREVVRQSETKPIDTSKTSDTMRTLTNVVVSLSWRGTNGNPTDVCHWADGYPLNIHLYV 326
                    ************************************************************************************************ PP

         DUF810 229 kLLeavFDvrdetqvleevdellellkktWsiLGinqklHnvcfaWvLfqqyvvtgqvepdLleaalaqlkevakdakk.tkeeaylkllssvlas 323
                    +LL+++FDvrdet vl+e+dellel+kktWs+LGi++++Hn+cf+WvLf+qyvvt+q+epdLl a++a+l+eva+dakk ++e++y+kll+s+las
  VIMSS10090404 327 ALLQSIFDVRDETLVLDEIDELLELMKKTWSTLGITRPIHNLCFTWVLFHQYVVTSQMEPDLLGASHAMLAEVANDAKKlDREALYVKLLNSTLAS 422
                    ************************************************************************************************ PP

         DUF810 324 iqeWaekrLldYHesFekgniesmenvlslallaakilaedvsseerkakeeeaassesdsaservetYirsSikaafarvlekvdakske...ke 416
                    +q+W+ekrLl+YH++F++gn++ +en+l+lal++++il edv+ ++ k +e+ +++  +d++++rv++YirsSik+af++v+e+++ak ++    e
  VIMSS10090404 423 MQGWTEKRLLSYHDYFQRGNVGLIENLLPLALSSSRILGEDVTISQGKGQEKGDVK-LVDHSGDRVDYYIRSSIKNAFSKVIENTKAKIAAtdeGE 517
                    **********************************************9998864444.5789**************************988777788 PP

         DUF810 417 ekeevLalLAketkelaekekevfspvLkrwhplaaavaavtLhklYgkeLkqflegvssltedvveVLqaAdkLekalvqlavedsadsedggks 512
                    e++ +L++LAket+ela +e+e+fsp+Lkrwh++aa+va v Lh++Yg+ L q+l+g s +++d+veVLq+A+kLek+lvq+++eds+++edggk 
  VIMSS10090404 518 EAAGTLLQLAKETEELALRERECFSPILKRWHSVAAGVASVSLHQCYGSILMQYLAGRSFISRDTVEVLQTAGKLEKVLVQMVAEDSEECEDGGKG 613
                    8999******************************************************************************************** PP

         DUF810 513 lvremkpYevesvianlvkkWvkerlkklkewveraleqEtWePkskqeryaqSavellriieetvdeffelpvpmkeellqdLldgldkllqeYl 608
                    lvrem+pYev+s+i +l+++Wv+e+lk ++e++ ra+e+EtW+Pksk+e+yaqSa el++++++t+deffe+p+ ++e+l++d+++gl++l+qeY+
  VIMSS10090404 614 LVREMVPYEVDSIILRLLRQWVEEKLKAVQECLFRAKETETWNPKSKSEPYAQSAGELMKLAKDTIDEFFEIPIGITEDLVHDIAEGLEQLFQEYT 709
                    ************************************************************************************************ PP

         DUF810 609 skvasslgskeslvPslPaLTRckedsklkklwkkkavepclld...............ekrksklnslgtqkLcvrLNTLhyllsqleslek 686
                    ++va s+g ++s++P+lP+LTRc++ds+++klwk+++  pc+++               ++r+s+  s+gtq+L++rLNTLh+l s+++sl+k
  VIMSS10090404 710 TFVA-SCGARQSYIPTLPPLTRCNRDSRFVKLWKRAT--PCTTSnedlkyttsvisdghHPRPST--SRGTQRLYIRLNTLHFLSSHIHSLNK 797
                    ****.********************************..555333589***********9*****..************************86 PP



Or compare VIMSS10090404 to CDD or PaperBLAST